PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01030127001
Common NameLOC100254423, VIT_12s0057g01350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family CO-like
Protein Properties Length: 416aa    MW: 44982.9 Da    PI: 4.7624
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01030127001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.61.9e-06444539
           zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                       +C+ ++e++ + +C+++   lC +C  + H+       H++
  GSVIVT01030127001  4 ICDFCGEQRSIVYCRSDAASLCLSCDRHVHSAnalsrrHSR 44
                       7*****************************65677777766 PP

2zf-B_box21.64.4e-074688440
           zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                         C++++++++   C + +  lC++C  ++H g      H+ +
  GSVIVT01030127001 46 LLCERCNSQPAFVRCIEEKISLCQNCDWTGHGGstttssHKKE 88
                       57*****************************668888888766 PP

3CCT62.51.3e-21358401144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        R  a++RY+eK+k+RkF+K++rY+sRKa+A+ R+RvKGrFvk+ 
  GSVIVT01030127001 358 RSSAVMRYREKKKNRKFDKRVRYASRKARADVRQRVKGRFVKAG 401
                        889**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.655147IPR000315B-box-type zinc finger
CDDcd000211.58E-7447No hitNo description
SMARTSM003363.0E-8447IPR000315B-box-type zinc finger
PROSITE profilePS501198.8454390IPR000315B-box-type zinc finger
CDDcd000218.75E-44778No hitNo description
PROSITE profilePS5101715.666358400IPR010402CCT domain
PfamPF062031.0E-16358400IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MGYICDFCGE QRSIVYCRSD AASLCLSCDR HVHSANALSR RHSRTLLCER CNSQPAFVRC  60
IEEKISLCQN CDWTGHGGST TTSSHKKETI NCYSGCPSSE GLSTMWPFVL DLPSTGNSTC  120
EQGLSLMCLN ETSEMNSWGP PGNSSRQDAS LTVEVNDANN VDKSSILIGS SSVPELNSPS  180
QKLDQPSGSA DLTLPKLLCP GTDDLGFCED DSLYEDFNMD EVDLNLENYE ELFGVALSHS  240
EQLFENGGID SLFGKMDTSG ADSHCQGAVI AEGSVGLANA VQPTYSNAAS ADSIMSSKTE  300
PILCFTGKQA HSSLSFSGLT GESSAGDYQD CGASPTFLMG EPPWCPPGPE SSLPSTSRSS  360
AVMRYREKKK NRKFDKRVRY ASRKARADVR QRVKGRFVKA GEAYDYDPIS ETRSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4241200.0AM424120.2 Vitis vinifera contig VV78X194150.19, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002264506.20.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
SwissprotQ9SSE51e-153COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLD7TDA30.0D7TDA3_VITVI; CONSTANS-like protein 9b
STRINGVIT_12s0057g01350.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-147CONSTANS-like 9