PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01030077001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 292aa    MW: 32465.4 Da    PI: 8.5585
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01030077001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.41.1e-10109148444
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
    Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                        W ++E+ ll+++++++G g+W+ +++++g ++   +c++++
  GSVIVT01030077001 109 WNADEEMLLLEGIEMYGLGNWSEVSEHVG-TKRKSECIDHY 148
                        *****************************.999999****9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5013510.794592IPR000433Zinc finger, ZZ-type
SMARTSM002911.1E-84590IPR000433Zinc finger, ZZ-type
PfamPF005692.8E-104680IPR000433Zinc finger, ZZ-type
SuperFamilySSF578505.06E-1248112No hitNo description
CDDcd023352.19E-234997No hitNo description
SuperFamilySSF466891.72E-11102155IPR009057Homeodomain-like
PROSITE profilePS5129321.937104156IPR017884SANT domain
SMARTSM007171.8E-9105154IPR001005SANT/Myb domain
PfamPF002492.3E-10108148IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-7109151IPR009057Homeodomain-like
CDDcd001676.53E-11109148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGRSRAVLHS TDDDQGSHRS KRRKTASTAD NLEGATAGQG MSEGKRASYH CNYCSKDISG  60
KIRTKCVVCP DFDLCIECFS IGAEVTPHVC FHPYRVMDNL SFPLICPDWN ADEEMLLLEG  120
IEMYGLGNWS EVSEHVGTKR KSECIDHYVA IYMNSPCFPL PDMSHVLGKT RAELLAMARG  180
EDEVKKGSPT HGELTLKVES PLSARVKVEE SRKEGPVVLS SSRLAAVTAV TNRSNPTWFL  240
AALKHLQVQL RGHLTWPRLR MVVITLKWKK LKQTEVLERK SLGPQGMRGL L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6cw3_E4e-38491645120Transcriptional adapter 2
6cw3_G4e-38491645120Transcriptional adapter 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.128220.0fruit
Functional Description ? help Back to Top
Source Description
UniProtRequired for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known. ADA2 and GCN5 function to acetylate nucleosomes, opening up the promoter region (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4671575e-94AM467157.2 Vitis vinifera contig VV78X228873.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657463.11e-160PREDICTED: transcriptional adapter ADA2
SwissprotQ75LL61e-96TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLA0A438DQ431e-162A0A438DQ43_VITVI; Transcriptional adapter
STRINGVIT_12s0057g00920.t011e-153(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2480912
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]