PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01029943001
Common NameLOC100241530, VIT_08s0056g01230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 466aa    MW: 49781.7 Da    PI: 7.1744
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01029943001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.72.9e-3999158261
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        ++k+l+cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ 
  GSVIVT01029943001  99 PDKILPCPRCNSLETKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKHL 158
                        7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3087156IPR003851Zinc finger, Dof-type
PfamPF027019.5E-32101157IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.714103157IPR003851Zinc finger, Dof-type
PROSITE patternPS013610105141IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MNGGDLAVSR DPAIKLFGTT IQTQICSNSP QKSLDAPSEI TKAEAEDPCA EDSRKPDGSS  60
VSEDGKEEQQ TQVQMSGLQV HKDQGETNSS AQEKVLKKPD KILPCPRCNS LETKFCYFNN  120
YNVNQPRHFC KNCQRYWTAG GTMRNVPVGA GRRKNKHLAS QYRQIMVSSD GVPTTVIEAS  180
DSSNQQILSC GETSTTFRPS TASGTVLKFG PEAPLCKSME TVLSIREQKR CAEMRTVNCG  240
GNGEEPSSCA SSVSAPSFPE NEFPENVGHK DRPSLPASPP VAPPQCSSDT VYAPNNSNPN  300
SVQWCSRPML AVPGFCAPTI PLQLVPPSYW GCMPIWGAGT GNISLAGSND CLSPSSSTSN  360
SCSGNASPTL GKHSRDAQPA EEQKLEKCVL VPKTLRIIDP DEASKSSIWA TLGIKPDQKA  420
PISKGGIFKA FEPKSGAKTD LSDATQVLEA NPAALSRSQT FKEST*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.58090.0bud| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4633810.0AM463381.2 Vitis vinifera contig VV78X135580.13, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275127.10.0PREDICTED: cyclic dof factor 3
TrEMBLA0A438HZS70.0A0A438HZS7_VITVI; Cyclic dof factor 2
TrEMBLF6HMX40.0F6HMX4_VITVI; Uncharacterized protein
STRINGVIT_08s0056g01230.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.29e-44cycling DOF factor 2