PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01029396001
Common NameVIT_17s0053g00780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 675aa    MW: 74786.9 Da    PI: 6.5973
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01029396001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.2e-192782156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       +++ +++t++q+++Le +F+++++p++++r +L+++l L  rq+k+WFqNrR+++k
  GSVIVT01029396001 27 KKRYHRHTAHQIQRLEGMFKECPHPDEKQRLQLSRELALAPRQIKFWFQNRRTQMK 82
                       678899***********************************************998 PP

2START182.32.7e-572264502206
                        HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
              START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                        +a  a++el+++ + +ep+W+ks     + +n + + ++f+++++       ++ea+r+sgvv+m++  lv +++d++ +W e ++     a
  GSVIVT01029396001 226 VAGNALDELLRLLQTNEPLWMKSTtdgrDVLNLESYERIFPRANShlknpnVRIEASRDSGVVIMNSLALVDIFMDSN-KWMELFPtivsMA 316
                        678899*******************99999**********99999******9**************************.***9999999899 PP

                        EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
              START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                         tlev+ssg      g lqlm+ elq+ls lvp R+f+f+Ry++q ++g+w+ivdvS d +++++  ++   +++lpSg+li++++ng+skv
  GSVIVT01029396001 317 RTLEVLSSGmmggqsGSLQLMYGELQVLSSLVPtREFYFLRYCQQIEQGSWAIVDVSYDFPRDNQ-FAPQNPSHRLPSGCLIQDMPNGYSKV 407
                        ****************************************************************9.788888999***************** PP

                        EEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 165 twvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                        twvehv+ ++++p h l+r l+++gla+ga +w+atlqr ce+
  GSVIVT01029396001 408 TWVEHVEIEDKTPtHRLYRDLIHRGLAFGAERWLATLQRMCER 450
                        *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-221586IPR009057Homeodomain-like
SuperFamilySSF466891.24E-191987IPR009057Homeodomain-like
PROSITE profilePS5007117.5082484IPR001356Homeobox domain
SMARTSM003895.0E-172588IPR001356Homeobox domain
CDDcd000867.25E-172685No hitNo description
PfamPF000465.2E-172782IPR001356Homeobox domain
PROSITE patternPS0002705982IPR017970Homeobox, conserved site
PROSITE profilePS5084850.16216453IPR002913START domain
SuperFamilySSF559612.54E-36217451No hitNo description
CDDcd088754.66E-119220449No hitNo description
SMARTSM002344.9E-48225450IPR002913START domain
PfamPF018521.2E-49226450IPR002913START domain
Gene3DG3DSA:3.30.530.201.7E-6279445IPR023393START-like domain
SuperFamilySSF559617.61E-23471645No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MEYGSGGGGG GSGGSGGDPD GSDSRRKKRY HRHTAHQIQR LEGMFKECPH PDEKQRLQLS  60
RELALAPRQI KFWFQNRRTQ MKAQHERADN CALRVENDKI RCENIAIREA LKNVICPSCG  120
GPPIGEDSYF DEQKLRVENA QLKEELDRVS SIAAKYIGRP ISQLPPVQPV HISSLDLSMG  180
SFGGQGMGSG PSLDLDLLPG SSSAMPILPF QGTGISDMDK SLMADVAGNA LDELLRLLQT  240
NEPLWMKSTT DGRDVLNLES YERIFPRANS HLKNPNVRIE ASRDSGVVIM NSLALVDIFM  300
DSNKWMELFP TIVSMARTLE VLSSGMMGGQ SGSLQLMYGE LQVLSSLVPT REFYFLRYCQ  360
QIEQGSWAIV DVSYDFPRDN QFAPQNPSHR LPSGCLIQDM PNGYSKVTWV EHVEIEDKTP  420
THRLYRDLIH RGLAFGAERW LATLQRMCER FACLMVKGTS TRDLGGVIPS PDGKRSMMKL  480
AQRMVNNFCA SISTSNGHRW TTLSGLNEVG VRVTIHKNTD PGQPNGVVLS AATTIWLPVS  540
PQNVFNFFRD ERTRPQWDVL SNGNAVQEVA HIANGPHPGN CISVLRAFNT SQNNMLILQE  600
SCIDSSGSLV IYCPVDLPAI NIAMSGEDPS YIPLLPSGFT ISPDGRLDQG DGATQQEHRM  660
VRVLTCVDEH HFYL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.111880.0cell culture| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During embryo development, expressed in all cells at the 4- and 16-cell embryo stages. Expression is restricted to the protoderm from the globular stage onward. {ECO:0000269|PubMed:25564655}.
UniprotTISSUE SPECIFICITY: Expressed in apical meristems and young epidermal tissue including trichomes and stipules. Expressed in lateral root tips, the L1 layer of apical inflorescence meristems and early flower primordia, carpel and petal epidermis, stigma papillae, ovule primordia, nucellus and embryo. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which acts as positive regulator of drought stress tolerance. Can transactivate CIPK3, NCED3 and ERECTA (PubMed:18451323). Transactivates several cell-wall-loosening protein genes by directly binding to HD motifs in their promoters. These target genes play important roles in coordinating cell-wall extensibility with root development and growth (PubMed:24821957). Transactivates CYP74A/AOS, AOC3, OPR3 and 4CLL5/OPCL1 genes by directly binding to HD motifs in their promoters. These target genes are involved in jasmonate (JA) biosynthesis, and JA signaling affects root architecture by activating auxin signaling, which promotes lateral root formation (PubMed:25752924). Acts as negative regulator of trichome branching (PubMed:16778018, PubMed:24824485). Required for the establishment of giant cell identity on the abaxial side of sepals (PubMed:23095885). May regulate cell differentiation and proliferation during root and shoot meristem development (PubMed:25564655). {ECO:0000269|PubMed:16778018, ECO:0000269|PubMed:18451323, ECO:0000269|PubMed:23095885, ECO:0000269|PubMed:24821957, ECO:0000269|PubMed:24824485, ECO:0000269|PubMed:25564655, ECO:0000269|PubMed:25752924}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4671700.0AM467170.2 Vitis vinifera contig VV78X070764.5, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002271012.10.0PREDICTED: homeobox-leucine zipper protein HDG11 isoform X2
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLF6HVV00.0F6HVV0_VITVI; Uncharacterized protein
STRINGVIT_17s0053g00780.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Khosla A, et al.
    HD-Zip Proteins GL2 and HDG11 Have Redundant Functions in Arabidopsis Trichomes, and GL2 Activates a Positive Feedback Loop via MYB23.
    Plant Cell, 2014. 26(5): p. 2184-2200
    [PMID:24824485]
  3. Horstman A, et al.
    AIL and HDG proteins act antagonistically to control cell proliferation.
    Development, 2015. 142(3): p. 454-64
    [PMID:25564655]
  4. Cai XT,Xu P,Wang Y,Xiang CB
    Activated expression of AtEDT1/HDG11 promotes lateral root formation in Arabidopsis mutant edt1 by upregulating jasmonate biosynthesis.
    J Integr Plant Biol, 2015. 57(12): p. 1017-30
    [PMID:25752924]
  5. Yu LH, et al.
    Arabidopsis EDT1/HDG11 improves drought and salt tolerance in cotton and poplar and increases cotton yield in the field.
    Plant Biotechnol. J., 2016. 14(1): p. 72-84
    [PMID:25879154]
  6. Zhu Z, et al.
    Overexpression of AtEDT1/HDG11 in Chinese Kale (Brassica oleracea var. alboglabra) Enhances Drought and Osmotic Stress Tolerance.
    Front Plant Sci, 2016. 7: p. 1285
    [PMID:27625663]
  7. Liu Y, et al.
    Overexpression of AtEDT1 promotes root elongation and affects medicinal secondary metabolite biosynthesis in roots of transgenic Salvia miltiorrhiza.
    Protoplasma, 2017. 254(4): p. 1617-1625
    [PMID:27915455]
  8. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]
  9. Lung SC, et al.
    Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.
    New Phytol., 2018. 218(1): p. 183-200
    [PMID:29288621]
  10. Zheng G, et al.
    Over-Expression of Arabidopsis EDT1 Gene Confers Drought Tolerance in Alfalfa (Medicago sativa L.).
    Front Plant Sci, 2017. 8: p. 2125
    [PMID:29326737]