PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01028852001
Common NameLOC100252586, VIT_16s0050g01180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 319aa    MW: 35031.6 Da    PI: 9.7771
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01028852001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.41.4e-124185147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  GSVIVT01028852001 41 REKWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 85
                       789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-153591IPR009057Homeodomain-like
PROSITE profilePS5129413.5033690IPR017930Myb domain
TIGRFAMsTIGR015574.5E-183988IPR006447Myb domain, plants
SMARTSM007178.0E-104088IPR001005SANT/Myb domain
PfamPF002492.6E-104185IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-64185IPR009057Homeodomain-like
CDDcd001679.11E-84386No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MALPGLGPFA TTAAAAAAAT TSSLEDPAKK IRKPYTITKC REKWTEPEHD KFLEALQLFD  60
RDWKKIEAFV GSKTVIQIRS HAQKYFLKVQ KNGINEHLPP PRPKRKAAHP YPHKASKNAP  120
VLSQGTGSFH SSAALRETGY VLRPDSSSIL RNPITSAAAS SWTNSKPAQT VGLSHVAKGD  180
MRSAGPTVPN NCCSSAESTP RGRTTVEASE QGNHVHTLRV LPDFVQVYRF IGSVFDPNST  240
GHLQKLKKMD PIDVETVLLL MRNLSINLTS PDFEDHRKLL STYEIDSETT SHGVESNKIP  300
QDDQTKDRAQ LGTKDKDE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.45700.0fruit| leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3830350.0FQ383035.1 Vitis vinifera clone SS0ABG34YD20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273319.20.0PREDICTED: protein REVEILLE 6
SwissprotQ8H0W31e-124RVE6_ARATH; Protein REVEILLE 6
TrEMBLF6H6C00.0F6H6C0_VITVI; Uncharacterized protein
STRINGVIT_16s0050g01180.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9281558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-109MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]