PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01028167001
Common NameLOC100265771, VIT_07s0005g01910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 446aa    MW: 49930.5 Da    PI: 9.8289
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01028167001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.82.1e-07129171346
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         WT eE ++l ++++++  + +  Ia +++  Rt +++k+r+++
  GSVIVT01028167001 129 TWTREETDQLFELCERFDLR-FIVIADRFPSSRTVEDLKNRYYS 171
                        7*******************.*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162822.2E-31102176IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007175.4E-8126175IPR001005SANT/Myb domain
SuperFamilySSF466895.06E-7128176IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-6129173IPR009057Homeodomain-like
CDDcd116582.97E-19130172No hitNo description
PfamPF054991.7E-6318381IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043967Biological Processhistone H4 acetylation
GO:0043968Biological Processhistone H2A acetylation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
GO:0003714Molecular Functiontranscription corepressor activity
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MDAKDILGLP KTPLTAPQEK KSRPQKDSQR KPDGISREVY ALTGGLAPLM PAVDVSQLKR  60
RPQSDEKVTW QWLPFTSSAR TDNLQLYHWV RVVNGVPPTG DYSFAKYNKS VNVVKYTDEE  120
YEKYLTDPTW TREETDQLFE LCERFDLRFI VIADRFPSSR TVEDLKNRYY SVSRAILVAR  180
APSSGDVSGH PLVKEPYNVS QEVERKRALS MILSQTKQQE RKDAEVLAEA KRITEARIAA  240
RGAEESDMPV ASNVSPESNE KNIIPVETVS PSSNVQIPPT TVAPPTSTAD DISTLNSLRG  300
MRVYLRTYAL EQMVQAASSS AGLRTIKRVE QTLQDLGVNL KPKVPTKSVC AEHLELRKEI  360
LTLLNLQKQL QYKEAEGSSH RDGSYVETPG TPKRSHRTGE QDRTFIPDSI SFGGERVGKR  420
DQKRKAPAPP SPAQSKRPRK LKASD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A3e-21101186493DNA methyltransferase 1-associated protein 1
4iej_A3e-21101186493DNA methyltransferase 1-associated protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. {ECO:0000305|Ref.5}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4341258e-94AM434125.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X114249.6, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278881.10.0PREDICTED: SWR1-complex protein 4
RefseqXP_010652285.10.0PREDICTED: SWR1-complex protein 4
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLD7U2M30.0D7U2M3_VITVI; Uncharacterized protein
STRINGVIT_07s0005g01910.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6713810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein
Publications ? help Back to Top
  1. Gómez-Zambrano Á, et al.
    Arabidopsis SWC4 Binds DNA and Recruits the SWR1 Complex to Modulate Histone H2A.Z Deposition at Key Regulatory Genes.
    Mol Plant, 2018. 11(6): p. 815-832
    [PMID:29604400]