PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01028126001
Common NameLOC100250283, VIT_07s0005g01500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family GRAS
Protein Properties Length: 583aa    MW: 65952.3 Da    PI: 5.6578
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01028126001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS285.91.2e-871935801374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal........... 81 
                        lv+ Ll++Ae v  +++e+a+++L+r + +as +g+p++R+++yf++AL++++ r  ++ +k ++   + +k+ ++  +a+           
  GSVIVT01028126001 193 LVHFLLSAAEKVGCQQFERASRFLTRCEWIASDTGNPVERIVFYFAKALREKIDR-ETGHFKGFK--GNGRKDLIDLGFATnlgngrkdlid 281
                        6899***************************************************.444444444..4444567777777778888888888 PP

               GRAS  82 .........klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetge 163
                                  + ++  P+++++++t  qaI+e v+ + ++H +D+ i  G+QW  L+qaLa+R+e+p   l+iT+v      +k+ +eetg+
  GSVIVT01028126001 282 lgfatnlasIACHQDLPFIQVTQFTGIQAIVEHVALSGKIHLVDLAIRSGVQWTVLMQALADRDESPVsLLKITAVTT---MDKNHVEETGK 370
                        8888766643488999************************************************7776489******9...68********* PP

               GRAS 164 rLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                        rL++fA++l++pf+fnv+ ++++++l+ e L+v+ +E++aV   l l ++     + +++ d +++++k+lsP ++vv+e ea+hns+sF++
  GSVIVT01028126001 371 RLESFAKSLNLPFSFNVVFVTEMKELKEELLAVEAEEVVAVYAPLVLRSMI----PRPDYLDVLMRVIKKLSPSIMVVTEVEANHNSPSFVT 458
                        *********************************************999998....77788899***************************** PP

               GRAS 256 rflealeyysalfdsleaklpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                        rf+eal +ysa+f +le+ +++++  + r+  E++++g+ i+n++a+eg+er+ r+ ++  Wr+ ++++G+ ++++se    qa+l++++++
  GSVIVT01028126001 459 RFIEALFFYSAFFHCLEVCMGSTTksQYRMITEAMFFGEGIRNMIAAEGEERVVRNVKMDVWRAFFSRFGMVEMEFSEASLYQASLIIKRFA 550
                        ******************9998776699**************************************************************** PP

               GRAS 346 .sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         +   ++e++ ++l+ gWk+ p+ s+SaW+
  GSVIVT01028126001 551 cGSCCSLEKDGKCLIVGWKGTPIHSLSAWK 580
                        9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.689167559IPR005202Transcription factor GRAS
PfamPF035144.0E-85193580IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009010anatomyseed
PO:0025501developmental stagefruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MAEALFSFEP FEFNGIQGGY GTLEGYEKDN SGKGKQDHLF GIEDWEEFES LCSQYGLFQE  60
SIPDKRAHFS KAQQQQQQSP RSNHWALDEL QFDTEPLHEP NREKPYPFSL SSLELLNNYG  120
GGVKKLKREN LSNISNEINA ERQRLSTEEV MRVAGARYVE FSSQRGDDFT LHMHPFGFAL  180
MGLSQEETKD VELVHFLLSA AEKVGCQQFE RASRFLTRCE WIASDTGNPV ERIVFYFAKA  240
LREKIDRETG HFKGFKGNGR KDLIDLGFAT NLGNGRKDLI DLGFATNLAS IACHQDLPFI  300
QVTQFTGIQA IVEHVALSGK IHLVDLAIRS GVQWTVLMQA LADRDESPVS LLKITAVTTM  360
DKNHVEETGK RLESFAKSLN LPFSFNVVFV TEMKELKEEL LAVEAEEVVA VYAPLVLRSM  420
IPRPDYLDVL MRVIKKLSPS IMVVTEVEAN HNSPSFVTRF IEALFFYSAF FHCLEVCMGS  480
TTKSQYRMIT EAMFFGEGIR NMIAAEGEER VVRNVKMDVW RAFFSRFGMV EMEFSEASLY  540
QASLIIKRFA CGSCCSLEKD GKCLIVGWKG TPIHSLSAWK FT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3822358033375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4594760.0AM459476.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X051051.14, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010652534.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLF6HZA20.0F6HZA2_VITVI; Putative uncharacterized protein
STRINGVIT_07s0005g01500.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.19e-47RGA-like 2