PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01027508001
Common NameLOC100260889, VIT_15s0048g02000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 772aa    MW: 83910.4 Da    PI: 6.1814
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01027508001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.3e-21113168156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t++q++eLe+lF+++++p++++r eL+++l+L++rqVk+WFqNrR+++k
  GSVIVT01027508001 113 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLSLETRQVKFWFQNRRTQMK 168
                        688999***********************************************999 PP

2START208.13.4e-652815051206
                        HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
              START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                        ela++a++elvk+a+ +ep+Wv+s     e++n +e++++f++  +     + +e  r++g+v+ ++  lve+l+d++ +W e+++    + 
  GSVIVT01027508001 281 ELALAAMDELVKMAQTDEPLWVRSLeggrEILNLEEYMRTFTPCIGmkpsgFVTESTRETGMVIINSLALVETLMDSN-RWAEMFPcmiaRT 371
                        5899**************************************9998999999**************************.************* PP

                        EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
              START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                        +t++vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +  + +v +++lpSg+++++++ng+skv
  GSVIVT01027508001 372 STTDVISSGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRETSVAPTFVNCRRLPSGCVVQDMPNGYSKV 463
                        ***************************************************************999************************** PP

                        EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        twveh++++++ +h+l+r+l++sg+ +ga++wvatlqrqce+
  GSVIVT01027508001 464 TWVEHAEYDESAVHQLYRPLLGSGMGFGAQRWVATLQRQCEC 505
                        ****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.77E-2196170IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-2299164IPR009057Homeodomain-like
PROSITE profilePS5007117.605110170IPR001356Homeobox domain
SMARTSM003894.1E-19111174IPR001356Homeobox domain
CDDcd000865.20E-19112170No hitNo description
PfamPF000461.7E-18113168IPR001356Homeobox domain
PROSITE patternPS000270145168IPR017970Homeobox, conserved site
PROSITE profilePS5084843.25272508IPR002913START domain
CDDcd088751.03E-127277504No hitNo description
SuperFamilySSF559612.38E-34277505No hitNo description
SMARTSM002349.6E-50281505IPR002913START domain
PfamPF018528.6E-57281505IPR002913START domain
SuperFamilySSF559615.63E-24534764No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 772 aa     Download sequence    Send to blast
MSFGGFLDNS SGGGGARIVA DIPYSNNMAT GAIAQPRLVS PSLAKSMFSS PGLSLALQTS  60
MEGQGEVTRL AENFESGGGR RSREDEHESR SGSDNMDGAS GDDQDAADNP PRKKRYHRHT  120
PQQIQELEAL FKECPHPDEK QRLELSRRLS LETRQVKFWF QNRRTQMKTQ LERHENSILR  180
QENDKLRAEN MSIRDAMRNP ICTNCGGPAI IGDISLEEQH LRIENARLKD ELDRVCALAG  240
KFLGRPISSL ASSMAPAMPS SSLELGVGSN GGISSTSMFL ELALAAMDEL VKMAQTDEPL  300
WVRSLEGGRE ILNLEEYMRT FTPCIGMKPS GFVTESTRET GMVIINSLAL VETLMDSNRW  360
AEMFPCMIAR TSTTDVISSG MGGTRNGALQ LMHAELQVLS PLVPVREVNF LRFCKQHAEG  420
VWAVVDVSID TIRETSVAPT FVNCRRLPSG CVVQDMPNGY SKVTWVEHAE YDESAVHQLY  480
RPLLGSGMGF GAQRWVATLQ RQCECLAILM SSTVPTRDHT AAITAGGRRS MLKLAQRMTD  540
NFCAGVCAST VHKWNKLCAG NVDEDVRVMT RKSVDDPGEP PGIVLSAATS VWLPVSPQRL  600
FDFLRDERLR SEWDILSNGG PMQEMAHIAK GQDHGNCVSL LRASAMNANQ SSMLILQETC  660
IDAAGSLVVY APVDIPAMHV VMNGGDSAYV ALLPSGFAIV PDGPGSRGPN SGVHTNSGGP  720
NRVSGSLLTV AFQILVNSLP TAKLTVESVE TVNNLISCTV QKIKAALHCE S*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.119590.0bud| flower| fruit
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4593070.0AM459307.2 Vitis vinifera contig VV78X101111.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002272264.20.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_010661561.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLF6I3160.0F6I316_VITVI; Uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]