PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01027407001
Common NameVIT_15s0048g02870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 194aa    MW: 22201.5 Da    PI: 4.4795
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01027407001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox42.61e-131391856
                       HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       +Fe++ ++  +++ + Ak+lgL+ rqV +WFqN+Ra++k
  GSVIVT01027407001  1 MFESETKLEPRKKLQVAKELGLQPRQVAIWFQNKRARWK 39
                       6999**********************************9 PP

2HD-ZIP_I/II101.38.5e-331771793
        HD-ZIP_I/II 17 sFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93
                       +Fe+e+kLep++K ++a+eLglqprqva+WFqn+RAR+k+kqlE+dy+ L+ +y++l+++ e+L+ke+++L  +l++
  GSVIVT01027407001  1 MFESETKLEPRKKLQVAKELGLQPRQVAIWFQNKRARWKSKQLERDYSILRGNYNSLVSRFESLKKEKQALVIQLQK 77
                       6999*******************************************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF000463.8E-11139IPR001356Homeobox domain
SMARTSM003890.0027145IPR001356Homeobox domain
PROSITE profilePS5007114.009141IPR001356Homeobox domain
SuperFamilySSF466892.47E-12253IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-13248IPR009057Homeodomain-like
CDDcd000862.67E-9242No hitNo description
PRINTSPR000312.5E-51221IPR000047Helix-turn-helix motif
PROSITE patternPS0002701639IPR017970Homeobox, conserved site
PRINTSPR000312.5E-52137IPR000047Helix-turn-helix motif
PfamPF021831.0E-164183IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MFESETKLEP RKKLQVAKEL GLQPRQVAIW FQNKRARWKS KQLERDYSIL RGNYNSLVSR  60
FESLKKEKQA LVIQLQKLNE MVQQSGGAKQ DSEQRLVQNS AESEADNRDN GNCESEVKPN  120
LSLERSEHGG GVLSDDDSSI RADYFVMEEE PSLLTMVEPV DGCLTSPEDW GSWDSENVFD  180
QSSGSYQWWD FWG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.24020.0bud| fruit| leaf| pedicel
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00320DAPTransfer from AT2G46680Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4591260.0AM459126.1 Vitis vinifera contig VV78X035546.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002262950.31e-140PREDICTED: homeobox-leucine zipper protein ATHB-12
SwissprotP468972e-58ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLA0A438IFA01e-138A0A438IFA0_VITVI; Homeobox-leucine zipper protein ATHB-7
TrEMBLF6I2W31e-138F6I2W3_VITVI; Uncharacterized protein
STRINGVIT_15s0048g02870.t011e-139(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.17e-61homeobox 7
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhou SF, et al.
    Membrane-associated transcription factor peptidase, site-2 protease, antagonizes ABA signaling in Arabidopsis.
    New Phytol., 2015. 208(1): p. 188-97
    [PMID:25919792]