PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01027184001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 298aa    MW: 32844 Da    PI: 8.6612
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01027184001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.5e-3941100261
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        k++a++cprC stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+s
  GSVIVT01027184001  41 KDQAVNCPRCSSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNVPVGGGSRKNKRS 100
                        7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-303499IPR003851Zinc finger, Dof-type
PfamPF027011.4E-334299IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8074599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MKEKENSIGE AKDMEEAISI SINSDHTCSK PVLERKARPQ KDQAVNCPRC SSTNTKFCYY  60
NNYSLTQPRY FCKTCRRYWT EGGTLRNVPV GGGSRKNKRS ITTSSSLSSS LTSSSSFKTH  120
LPDLNPPILS HFSSENPRIH EPHDLNLAFP LPQYYHGISQ FAELLKTGIT SRGLSSFVPA  180
PMPDSSSTLF TSGFPLQEFK VPHLSFSAHL HGVDPQQNMS TTGRVLFPFG EVKQLPATTS  240
TGVDHDCSGN NKGQGSPATA AYWNNGITSV MNLIEKWSLS QLVTTNLHFM EVLFLSI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.115380.0cell culture| fruit| pedicel
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Turned off in siliques when they reached full maturation. Not expressed in developing or mature embryos.
UniprotTISSUE SPECIFICITY: Expressed in the phloem of the mother plant, including in roots, stem, leaves and flowers, but not present in the seed and embryo. In maturing siliques, found all through the funiculus connecting the placenta to the ovule, but not in the ovule.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the inactivity of a component that would be activated to trigger germination as a consequence of red light perception.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4785020.0AM478502.2 Vitis vinifera contig VV78X197834.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661971.10.0PREDICTED: dof zinc finger protein DOF2.5 isoform X2
SwissprotQ433857e-60DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A438IF871e-179A0A438IF87_VITVI; Dof zinc finger protein DOF3.7
TrEMBLA5C1651e-179A5C165_VITVI; Uncharacterized protein
STRINGVIT_15s0046g00150.t011e-180(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.36e-60Dof family protein