PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01027172001
Common NameVIT_15s0046g00240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 154aa    MW: 17318.8 Da    PI: 6.2533
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01027172001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260106.22.6e-332948100
             DUF260   8 lrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                        lrr+C +dC+lapyfp+ + +kfa vhk+FGasnv+k+++ ++e++reda+++++yeA  r+rdPvyG++g i++lq+ ++ l+++l+++++
  GSVIVT01027172001   2 LRRRCDRDCILAPYFPSYEIEKFAGVHKVFGASNVIKMIQMVEESRREDAVKAIIYEATTRLRDPVYGSAGAIFHLQKMIQDLNTQLDSIRT 93 
                        89************************************************************************************998877 PP

             DUF260 100 e 100
                        +
  GSVIVT01027172001  94 Q 94 
                        6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.525195IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-33192IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MLRRRCDRDC ILAPYFPSYE IEKFAGVHKV FGASNVIKMI QMVEESRRED AVKAIIYEAT  60
TRLRDPVYGS AGAIFHLQKM IQDLNTQLDS IRTQTLVLRE QRDQLLGILK NVHRRDPVSP  120
IDFPTFGDAG SLSIDDTVGC GPSSFPSDCD WIL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-30110817122LOB family transfactor Ramosa2.1
5ly0_B2e-30110817122LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.66530.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4537330.0AM453733.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X087152.2, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002265542.11e-111PREDICTED: LOB domain-containing protein 1
TrEMBLA0A438IFC01e-110A0A438IFC0_VITVI; LOB domain-containing protein 11
STRINGVIT_15s0046g00240.t011e-110(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1325945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-38LOB domain-containing protein 1