PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01026956001
Common NameLOC100855334, VIT_15s0046g02260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 329aa    MW: 36322.2 Da    PI: 9.6378
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01026956001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-1357101147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  GSVIVT01026956001  57 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 101
                        789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-1651107IPR009057Homeodomain-like
PROSITE profilePS5129415.40852106IPR017930Myb domain
TIGRFAMsTIGR015571.5E-1855104IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-655107IPR009057Homeodomain-like
SMARTSM007175.3E-1156104IPR001005SANT/Myb domain
PfamPF002492.7E-1157101IPR001005SANT/Myb domain
CDDcd001672.01E-859102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MVSVNPNPPQ GFYLDPMQMG LPALGSLQPT TASVAASSSS EDPNKKIRKP YTITKSRESW  60
TEQEHDKFLE ALQLFDRDWK KIEAFVGSKT VIQIRSHAQK YFLKVQKNGT SEHVPPPRPK  120
RKAAHPYPQK ASKNAPVFPQ DTMAFQTSAT LLEPGFVLRP DSSSVLRNPM NNAALSSWTY  180
NSQPPVSVSH VTKDEVGLAG PAMQHNNCCS SSNESTPRSW PICKTHDQGN QSLPIRVMPD  240
FAQVYSFIGS VFDPNGSGHL QKLKNMDPIN METVLLLMRN LTINLTSPEF ADHRKLLSSY  300
DADFEKAKSS STRSILHVGK SESAILSA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.126690.0fruit
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3815650.0FQ381565.1 Vitis vinifera clone SS0ABP1YE10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661807.10.0PREDICTED: protein REVEILLE 6
SwissprotQ8H0W31e-112RVE6_ARATH; Protein REVEILLE 6
TrEMBLD7UCD40.0D7UCD4_VITVI; Uncharacterized protein
STRINGVIT_15s0046g02260.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9281558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.18e-98MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]