PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01026588001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Trihelix
Protein Properties Length: 540aa    MW: 61920.4 Da    PI: 8.317
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01026588001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix91.96.7e-2967151187
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                        rW+++e+laL+++r++m+  +r+++lk+plWeevs+k+ e g++r++k+Ckek+en+ k++k++keg+++r  ++ +++++f+qlea
  GSVIVT01026588001  67 RWPREETLALLKIRSDMDVVFRDSSLKAPLWEEVSRKLGELGYHRNAKKCKEKFENIFKYHKRTKEGRSNR--QNGKNYRFFEQLEA 151
                        8*********************************************************************8..45567*******85 PP

2trihelix1055.2e-33307392187
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                        rW+k ev aLi++r++ + +++++  k+plWee+s +mr+ g+ers+k+Ckekwen+nk++k++++++k+r +e+s+tcpyf+ql+a
  GSVIVT01026588001 307 RWPKAEVEALIRLRTNFDMQYQESGPKGPLWEEISLAMRKIGYERSAKRCKEKWENINKYFKRVRDSNKRR-PEDSKTCPYFHQLDA 392
                        8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.24860124IPR017877Myb-like domain
SMARTSM007170.006764126IPR001005SANT/Myb domain
PfamPF138379.2E-1966152No hitNo description
CDDcd122031.82E-2366131No hitNo description
PROSITE profilePS500907.422300364IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.7E-4304363IPR009057Homeodomain-like
SMARTSM007170.0045304366IPR001005SANT/Myb domain
PfamPF138375.6E-22306393No hitNo description
CDDcd122036.28E-24306371No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MDEREFCLFI FFFFKLMLGI SDFPESSGTA SGGREGEDGG GGAVPTGCEE EERVRGEESD  60
RNFAGNRWPR EETLALLKIR SDMDVVFRDS SLKAPLWEEV SRKLGELGYH RNAKKCKEKF  120
ENIFKYHKRT KEGRSNRQNG KNYRFFEQLE ALDNHPLMPP PSPVKYETST PMAASMPQTN  180
PIDVTNVSQG INAVPCSIQK PAVDCVAAST STTSSSGKES EGSRKKKRKW GVFFEKLMKE  240
VIEKQENLQR KFIEAIEKCE QDRIAREEAW KLQELDRIKR EHEILVQERS IAAAKDAANS  300
IQMSSSRWPK AEVEALIRLR TNFDMQYQES GPKGPLWEEI SLAMRKIGYE RSAKRCKEKW  360
ENINKYFKRV RDSNKRRPED SKTCPYFHQL DALYKEKTKK VENPDNNSGY NLKPEDILMQ  420
MMGQSEQRPQ SESVTEEGLH FLRLGTLYTL FNYQNSLRVS QSYLIVDMAF SPLIMCATLL  480
LVLLDAQWNQ LGYCGQTELQ PLAPPIEGCG VLAYGSRLVA NQVRDGKKKF SFWGFNLFE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.169330.0fruit| inflorescence| leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4664130.0AM466413.2 Vitis vinifera contig VV78X268871.2, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002276933.10.0PREDICTED: trihelix transcription factor GT-2
SwissprotQ391177e-97TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A438CNK70.0A0A438CNK7_VITVI; Trihelix transcription factor GT-2
TrEMBLF6I0I80.0F6I0I8_VITVI; Uncharacterized protein
STRINGVIT_04s0044g00510.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-72Trihelix family protein