PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01025199001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family GATA
Protein Properties Length: 387aa    MW: 42442 Da    PI: 8.3796
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01025199001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.12.1e-17176208133
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 
                        C +C++t Tp+WR+gp+g+ktLCnaCG++y++ 
  GSVIVT01025199001 176 CMHCNVTRTPQWREGPNGPKTLCNACGVCYKRG 208
                        99*****************************85 PP

2GATA52.85.5e-17299332134
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                        C +C + +TplWR+gp g+k+LCnaCG++y++ +
  GSVIVT01025199001 299 CMHCEAAQTPLWRQGPWGPKSLCNACGIRYKSGR 332
                        99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004017.6E-11170220IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.3E-13175207IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.596175206IPR000679Zinc finger, GATA-type
CDDcd002021.18E-12175222No hitNo description
SuperFamilySSF577165.23E-13175233No hitNo description
PROSITE patternPS003440176201IPR000679Zinc finger, GATA-type
PfamPF003202.5E-14176208IPR000679Zinc finger, GATA-type
SMARTSM004015.6E-13293343IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.7E-14297330IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.28E-13297356No hitNo description
PROSITE profilePS5011412.202297329IPR000679Zinc finger, GATA-type
CDDcd002024.55E-11298345No hitNo description
PROSITE patternPS003440299324IPR000679Zinc finger, GATA-type
PfamPF003209.1E-15299332IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MIDSGLFDEN GNGNDHSSDD MFDGIIDIFD FPMEDVDIGG EVEELQRESS PLNDLLALPC  60
PFSGNSCNDT SNLRTIPSDE APRTEPIVID TCSGNISLHG DSSDDKESLL LQNSTTSESG  120
KSASEPFAQT IEASEGYPNF MKGKQKKKKR KKLSLLSGAM GVKKQWWQQP ITIGRCMHCN  180
VTRTPQWREG PNGPKTLCNA CGVCYKRGSL FPEYRPASSP TFVPSLHTNS RRKVTEMRHK  240
AVSPIPVATL PSPHRKVIKM RSNGGQEAAM ATTPTFVASL HSNSHKKCSF QQPVTVRKCM  300
HCEAAQTPLW RQGPWGPKSL CNACGIRYKS GRLFPEYHPA ASPTFVASLH SNSHKKVLEM  360
RNQATQQQLS LAATDTAMSH PSQLIP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1145150KKKKRK
2145151KKKKRKK
3145152KKKKRKKL
4147151KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4388760.0AM438876.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X090426.6, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651174.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_010651175.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_010651176.10.0PREDICTED: GATA transcription factor 8-like
TrEMBLF6GU150.0F6GU15_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g02740.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.21e-33GATA family protein