PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01025159001
Common NameLOC100243320, VIT_06s0004g03130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ARF
Protein Properties Length: 799aa    MW: 88194.4 Da    PI: 6.1451
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01025159001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.65.6e-24167268199
                        EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                        f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   +
  GSVIVT01025159001 167 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyK-QQRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL--R 255
                        99****************************963.3445679************************************************..4 PP

                        SSEE..EEEEE-S CS
                 B3  87 rsefelvvkvfrk 99 
                         +++el+++++r+
  GSVIVT01025159001 256 GEGGELRLGIRRA 268
                        499*******996 PP

2Auxin_resp121.56.2e-40293374182
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                        aa+a++tks+F+v+Y+Pras++eFv++++k++k++++++s+G+Rfkm+++++ds+err sG+v+g+ dldp+rWpnSkWr+L
  GSVIVT01025159001 293 AANAVATKSMFHVFYSPRASHAEFVIPYQKYVKSITNPISIGTRFKMRYDMDDSPERRSSGVVTGIGDLDPYRWPNSKWRCL 374
                        799******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.58E-44159276IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-40160278IPR015300DNA-binding pseudobarrel domain
CDDcd100176.75E-23165267No hitNo description
PROSITE profilePS5086312.802167269IPR003340B3 DNA binding domain
SMARTSM010191.1E-23167269IPR003340B3 DNA binding domain
PfamPF023625.8E-22167268IPR003340B3 DNA binding domain
PfamPF065077.1E-34293374IPR010525Auxin response factor
SuperFamilySSF542773.38E-10666749No hitNo description
PfamPF023098.0E-6666754IPR033389AUX/IAA domain
PROSITE profilePS5174522.682670754IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MEIDLNHAVT EVEKHAFCNG DCDKASCVCC LSSSSSSSSA SNSSASPDSS SIYLELWHVC  60
AGRLTSLPKK GNVVVYFPQG HLEQAASSSP FPPMDISTFD LPPQIFCRVV NVQLLANKEN  120
DEVYTQVTLL PQPELAGINL EGKELEGLGV DEEGGGGSPT KSTPHMFCKT LTASDTSTHG  180
GFSVPRRAAE DCFPPLDYKQ QRPSQELVAK DLHGVEWRFR HIYRGQPRRH LLTTGWSIFV  240
SQKNLVSGDA VLFLRGEGGE LRLGIRRAVR PRNGLPDSII GNQNSYPNVL SLAANAVATK  300
SMFHVFYSPR ASHAEFVIPY QKYVKSITNP ISIGTRFKMR YDMDDSPERR SSGVVTGIGD  360
LDPYRWPNSK WRCLMVRWDD DIVSDPQERV SPWEIDPSVS LPPLSIQSSP RLKKLRTSLQ  420
ATPPNNPING GGGFLDFEES VRSSKVLQGQ ENVGFVSPLY GCDKVNRSLD FEMQNPSLAS  480
TGIEKANFCE FMRAPPTTYT GFLESDRFPK VLQGQEIGPL RSLAGKSDFN LGSWGKPNLG  540
CNLFNMYQKP KPNFYPLASE GIRNMYFPYN DIYKGGQDPV MLSYASNFPR ENVPFNPSSI  600
RSGVIGTEVR KLNIPNEPKP PENISAPPNL ETNLKHQKDD TFSGTAAGCK LFGFSLTGET  660
PPNSQNSGKR SCTKVHKQGN LVGRAIDLSR LNGYGDLFSE LERLFGMEGL LRDPDKGWQI  720
LYTDSENDMM VVGDDPWHEF CNVVSKIHIY TQEEVEKMTI GIISDDTQSC LEEAPVILDV  780
SKSSSVGQPD SSPTVIRI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-118383972354Auxin response factor 1
4ldw_A1e-118383972354Auxin response factor 1
4ldw_B1e-118383972354Auxin response factor 1
4ldx_A1e-118383972354Auxin response factor 1
4ldx_B1e-118383972354Auxin response factor 1
4ldy_A1e-118383972354Auxin response factor 1
4ldy_B1e-118383972354Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.201940.0bud| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3817460.0FQ381746.1 Vitis vinifera clone SS0ABG85YN24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002285019.20.0PREDICTED: auxin response factor 4
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLD7SKV90.0D7SKV9_VITVI; Auxin response factor
STRINGVIT_06s0004g03130.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10049811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  3. Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV
    Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.
    Plant Physiol. Biochem., 2016. 104: p. 146-54
    [PMID:27031426]
  4. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  5. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  6. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]