PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01025128001
Common NameLOC100251969, VIT_06s0004g03330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 203aa    MW: 22028.9 Da    PI: 4.5045
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01025128001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.97.1e-43401391100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+ql++l+a
  GSVIVT01025128001  40 PCAACKILRRRCADKCVLAPYFPPTDPAKFTTAHRVFGASNIIKFLQELPEFQRADAVSSMVYEAQARIRDPVYGCAGAICQLQKQLDELQA 131
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +la++++e
  GSVIVT01025128001 132 QLAKTQAE 139
                        ****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.21939140IPR004883Lateral organ boundaries, LOB
PfamPF031957.9E-4340137IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MECSDSTAAT NNSSCSSSSP RSLSPSSSSS PPPPNVVLSP CAACKILRRR CADKCVLAPY  60
FPPTDPAKFT TAHRVFGASN IIKFLQELPE FQRADAVSSM VYEAQARIRD PVYGCAGAIC  120
QLQKQLDELQ AQLAKTQAEL VNMQCQQANL VTMICMEMEM SQSPQPSSEE SLDSLISPQS  180
YQSNSFFLDD SNIGATWEPL WT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-433914710118LOB family transfactor Ramosa2.1
5ly0_B2e-433914710118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4251770.0AM425177.2 Vitis vinifera contig VV78X213648.5, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002282070.11e-147PREDICTED: LOB domain-containing protein 1
SwissprotQ9SK082e-73LBD11_ARATH; LOB domain-containing protein 11
TrEMBLD7SKT61e-145D7SKT6_VITVI; Uncharacterized protein
STRINGVIT_06s0004g03330.t011e-146(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.17e-69LOB domain-containing protein 1