PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01025126001
Common NameLOC104879565, VIT_06s0004g03350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 205aa    MW: 21945 Da    PI: 5.7172
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01025126001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.78.1e-43401391100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a
  GSVIVT01025126001  40 PCAACKILRRRCAEKCVLAPYFPPTDPAKFTTAHRVFGASNIIKFLQELPEYQRADAVSSMVYEAQARIRDPVYGCTGAICQLQKQVSELQA 131
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +la++++e
  GSVIVT01025126001 132 QLAKAQAE 139
                        ****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.35139140IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-4340137IPR004883Lateral organ boundaries, LOB
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025242anatomyinfructescence axis
PO:0007017developmental stagesporophyte senescent stage
PO:0007089developmental stagestem elongation stage
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MACSDPTSAP NPTTTSPSSP HSLSPPSSST PPPPTVVLSP CAACKILRRR CAEKCVLAPY  60
FPPTDPAKFT TAHRVFGASN IIKFLQELPE YQRADAVSSM VYEAQARIRD PVYGCTGAIC  120
QLQKQVSELQ AQLAKAQAEL VNMQCQQANL IAIICMEMSG SPQPSSFQQS LDSFISPPSY  180
QSGSCFLDDN ITGAAWEPLW TSSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-443915110122LOB family transfactor Ramosa2.1
5ly0_B1e-443915110122LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4481620.0AM448162.1 Vitis vinifera contig VV78X232060.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651120.11e-148PREDICTED: LOB domain-containing protein 1
SwissprotQ9SK087e-74LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A438KNS21e-146A0A438KNS2_VITVI; LOB domain-containing protein 11
TrEMBLD7SKT41e-146D7SKT4_VITVI; Uncharacterized protein
STRINGVIT_06s0004g03350.t011e-147(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-60LOB domain-containing protein 1