PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01025119001
Common NameLOC100243211, VIT_06s0004g03420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 273aa    MW: 30273.8 Da    PI: 8.0474
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01025119001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof129.11.3e-403495263
             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                       +e+alkcprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  GSVIVT01025119001 34 PEQALKCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRSSS 95
                       6899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-302392IPR003851Zinc finger, Dof-type
PfamPF027013.0E-343692IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6463892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MDASSAQRQE MDTQSLESML VCSKAQQERK PRPPEQALKC PRCDSTNTKF CYYNNYSLSQ  60
PRYFCKSCRR YWTKGGTLRN VPVGGGCRKN KRSSSSSSSK RTQDQPLTTN PNPLNVLPPL  120
TYDSNDLTLA FARLQKQTGG QLGYDDHHHD LALMGNPNNT HCDVLGNQCV NTCGTTTPGL  180
LDALRTNFLE TPSGYHNLYY GFEMSGATTT AVTVTTMKQE LCHGREGENR VLWGFPWQQL  240
NPDGSMGEVD SGRESWNGLA SSWHGLLNSP LM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4498730.0AM449873.2 Vitis vinifera contig VV78X180438.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284859.30.0PREDICTED: dof zinc finger protein DOF2.1
TrEMBLF6GTX30.0F6GTX3_VITVI; Uncharacterized protein
STRINGVIT_06s0004g03420.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.12e-49Dof family protein