PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01024986001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 228aa    MW: 25244.1 Da    PI: 9.7066
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01024986001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-3962122262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nkks+
  GSVIVT01024986001  62 PETALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKKSK 122
                        67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3546118IPR003851Zinc finger, Dof-type
PfamPF027016.8E-3364120IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.46966120IPR003851Zinc finger, Dof-type
PROSITE patternPS01361068104IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MVFSSVPLYP DPLNWQQQPN RQEGSGNENP QLPPPPPQAG SLGSIRPGSM ADRARVAKIP  60
QPETALKCPR CESTNTKFCY FNNYSLTQPR HFCKTCRRYW TRGGALRNVP VGGGCRRNKK  120
SKSSSSKSPA STERHAGSNS TIGLSAEGVE QWRLQQVQQF PFLGSFEPPT GLYPFQNEDL  180
TAVKLLENQG LNLSRQFLDT SENNQYWVGN AWTDFSGLNS SSTSNRL*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in roots. {ECO:0000269|PubMed:10758484}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. {ECO:0000269|PubMed:12887587}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA). Repressed by jasmonic acid (JA). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:12887587}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4281130.0AM428113.2 Vitis vinifera contig VV78X076016.5, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019075889.18e-85PREDICTED: dof zinc finger protein DOF3.6
SwissprotQ9M2U12e-49DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLA5AJG02e-83A5AJG0_VITVI; Uncharacterized protein
TrEMBLF6GV232e-83F6GV23_VITVI; Uncharacterized protein
STRINGVIT_06s0004g04520.t013e-84(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-47DNA binding with one finger 2.4