PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01024794001
Common NameLOC100244960, VIT_06s0004g06100, VITISV_033664
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 216aa    MW: 24168.3 Da    PI: 10.206
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01024794001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.2e-1558102347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
  GSVIVT01024794001  58 PWTEEEHKLFLLGLKKYGKGDWRNISRNFVVTRTPTQVASHAQKY 102
                        8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512935.879122IPR017884SANT domain
PROSITE profilePS5129420.71351107IPR017930Myb domain
SuperFamilySSF466893.44E-1752106IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-1854106IPR006447Myb domain, plants
SMARTSM007174.5E-1355105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-1255102IPR009057Homeodomain-like
PfamPF002496.3E-1358102IPR001005SANT/Myb domain
CDDcd001674.01E-1258103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MIPGKTVGDV FKQYKELELD VGKIEAGLVP IPGYSTSPFT LEPSSTRPTD QERKKGVPWT  60
EEEHKLFLLG LKKYGKGDWR NISRNFVVTR TPTQVASHAQ KYFIRQLSGG KDKRRASIHD  120
ITTVNLTDTR TPSPENKRPP SPDQTTFQWS QPNSGAPMAF NPTHGNIFMS SPYGMNSYGL  180
KMQGQNLHRA AFNESYIGPQ SMVFQMQSTP HFPHG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.10271e-173fruit| inflorescence
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}.
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4625911e-129AM462591.2 Vitis vinifera contig VV79X002449.2, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002280403.11e-151PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-107DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA5BKF31e-149A5BKF3_VITVI; Uncharacterized protein
STRINGVIT_06s0004g06100.t011e-150(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.16e-61Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Velasco R, et al.
    A high quality draft consensus sequence of the genome of a heterozygous grapevine variety.
    PLoS ONE, 2007. 2(12): p. e1326
    [PMID:18094749]
  3. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]