PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01024662001
Common NameLOC100251897, VIT_06s0004g07200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 164aa    MW: 18235.8 Da    PI: 6.8947
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01024662001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.56.3e-4561051100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ 
  GSVIVT01024662001   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVHQRIDAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQLQM 97 
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +la++++e
  GSVIVT01024662001  98 QLAVAQTE 105
                        ***99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9745106IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MGGSSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPVHQRI  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQN QVSQLQMQLA VAQTEILCIQ MQQEEPALPT  120
QMDQDEKSLL LSNNSFNNLQ HYLSFASSSN VIQDPLKRES LWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-5021197127LOB family transfactor Ramosa2.1
5ly0_B1e-5021197127LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3786260.0FQ378626.1 Vitis vinifera clone SS0AEB13YA05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278121.21e-119PREDICTED: LOB domain-containing protein 12
RefseqXP_019075938.11e-119PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW35e-81LBD12_ARATH; LOB domain-containing protein 12
TrEMBLD7SJR81e-118D7SJR8_VITVI; Uncharacterized protein
STRINGVIT_06s0004g07200.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-80LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]