PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01024592001
Common NameLOC100262112, VIT_06s0004g07790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 230aa    MW: 24921.4 Da    PI: 8.478
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01024592001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.92.2e-40441431100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e++r da++slv+eA+ r+rdPvyG++g i++lq+q+++l++
  GSVIVT01024592001  44 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLMDVAENQRADAVNSLVFEANLRLRDPVYGCMGAISALQHQVHSLQT 135
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        el+++k+e
  GSVIVT01024592001 136 ELNAVKAE 143
                        ****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.37843144IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4044141IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MSRERERLFD EVGKKIKRET DHKSSHMGRR QLLGPPGTLN TITPCAACKL LRRRCAEECP  60
FSPYFSPHEP HKFAAVHKVF GASNVSKMLM DVAENQRADA VNSLVFEANL RLRDPVYGCM  120
GAISALQHQV HSLQTELNAV KAEILKYKYR EAASTIISSS HAALVSSESD SISAVSLPSS  180
LPPPPLPLPP PTPSVVSSSP PSASSLYTIL PSSTTGYSSI TSDNIPYFD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-44361513118LOB family transfactor Ramosa2.1
5ly0_B3e-44361513118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.199540.0fruit
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4256380.0AM425638.2 Vitis vinifera contig VV78X076982.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002269676.11e-167PREDICTED: LOB domain-containing protein 15 isoform X1
SwissprotQ8L5T51e-80LBD15_ARATH; LOB domain-containing protein 15
TrEMBLD7SJL61e-166D7SJL6_VITVI; Uncharacterized protein
STRINGVIT_06s0004g07790.t011e-167(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.14e-80LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]