PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01024385001
Common NameVIT_16s0039g01920
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 298aa    MW: 33315.1 Da    PI: 4.6801
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01024385001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.63.8e-101053346
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        WT+eEd++l++  +++++ +W +Ia+   ++Rt+k+c + w +
  GSVIVT01024385001 10 LWTPEEDDKLKEFRHKYPNLSWPAIAKQAELNRTGKSCWESWEN 53
                       5*************************************766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.341359IPR017930Myb domain
SMARTSM007179.6E-9757IPR001005SANT/Myb domain
SuperFamilySSF466892.2E-178107IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-181062IPR009057Homeodomain-like
CDDcd001676.69E-81155No hitNo description
PfamPF139213.9E-121171No hitNo description
SMARTSM007170.009860108IPR001005SANT/Myb domain
PROSITE profilePS512948.74760110IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-1463109IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MARTQQKKSL WTPEEDDKLK EFRHKYPNLS WPAIAKQAEL NRTGKSCWES WENNLNPDIN  60
KGEFSPQEDE LIIPLKSAGV SWASMAKNDL RGRAPNAIKN RWNNHLKKRH AIISDLRRHL  120
LYLEEHLMDD KASDYSVRGG DLKALMAEFA SLIPNVDPNE TSDHSIRGDD LEALMAKFAS  180
LIPNVDPNES SDHSIREDDL EALMAKFASL IPNVDANETS DRSIRGDDLE TSDHSIRGDD  240
LEALMAKFAS LIPNVDPNET SDHSIRGDDL EALMAKFASL IPNVDPSAIS SIPEYTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1681097107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4773131e-167AM477313.2 Vitis vinifera contig VV78X067047.2, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010662108.10.0PREDICTED: myb-related protein 315
TrEMBLD7T7N80.0D7T7N8_VITVI; Uncharacterized protein
STRINGVIT_16s0039g01920.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-26myb domain protein 93