PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01024194001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family GATA
Protein Properties Length: 353aa    MW: 38599.6 Da    PI: 8.3923
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01024194001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.86.4e-18279312134
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                        Cs+C + kTp+WR gp g+ktLCnaCG+++++ +
  GSVIVT01024194001 279 CSHCLVQKTPQWRTGPLGPKTLCNACGVRFKSGR 312
                        *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004017.2E-13273323IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.385273309IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.98E-14273335No hitNo description
Gene3DG3DSA:3.30.50.101.3E-13277310IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.09E-11278335No hitNo description
PfamPF003201.1E-15279312IPR000679Zinc finger, GATA-type
PROSITE patternPS003440279304IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MRWRCGIGPN KGRLEYFHWR EIKDKPLTQS KPLIIFQCCC LWNLSRLPLF NLCSSLSGMD  60
QCIESRALKE SLRREAAMKT TPQVLYDDVL CGAGVNGVSG EDFSVDDLFD FSNGGLGVGV  120
DDDNSNSSSF SGTGDFESLS AGGLAVPADD LEHLEWLSHF VDDSSASELS LLCPAVTGNS  180
PSKRCEEEPR PALLRTPLFP TPLPAKPRSK RHRSSGRAWA FGSHSPSSSP SSSSSSSSTS  240
CLIFANTVHN MESFYSLEKP PAKKPKKSPS ADSQPQRRCS HCLVQKTPQW RTGPLGPKTL  300
CNACGVRFKS GRLFPEYRPA CSPTFSVEIH SNSHRKVLEI RRKKETAEPV SG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.84640.0inflorescence| pedicel
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4265880.0AM426588.2 Vitis vinifera contig VV79X001623.2, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002274872.11e-169PREDICTED: GATA transcription factor 5
SwissprotQ9FH574e-67GATA5_ARATH; GATA transcription factor 5
TrEMBLF6I1951e-169F6I195_VITVI; Putative uncharacterized protein
STRINGVIT_03s0038g00490.t011e-169(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.28e-48GATA transcription factor 5