PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01023816001
Common NameVIT_03s0038g04460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 993aa    MW: 107734 Da    PI: 4.5719
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01023816001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.2e-13835876245
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         rW++ + el+++av+q+G++ ++ I++ ++ gRt++q+k+++ 
  GSVIVT01023816001 835 SRWSKSDTELFYEAVQQFGTD-FSMIMQLFP-GRTRNQVKLKYK 876
                        69*******************.*********.**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159636.5E-27827911No hitNo description
Gene3DG3DSA:1.10.10.609.0E-8833876IPR009057Homeodomain-like
SMARTSM007171.0E-9833881IPR001005SANT/Myb domain
SuperFamilySSF466891.27E-11835884IPR009057Homeodomain-like
CDDcd001674.93E-8836877No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 993 aa     Download sequence    Send to blast
MGFDLDPLDD VLPEPAAINA RAGGKFQPKA KARPRKGTSA SVPSTISNAT KEKTIRPTTT  60
GSDTTQSLRP IDVIQNGLND TVGSSLDTSE IGGSKDTLKD HEGLVGGVSF TDNNRSLASV  120
SSLSQVFASG EDVGTTGAPP SETGAPHPGA ISDGNGDWHS SFGKKLKNYE GSPSELQFPR  180
ESRSSFLVNP SSQLLVEDLG STDALHSEVA ASDGNGDWVS SFGKSVGEAD TLGFDLDPFD  240
DILPGPATSN VRGSGKFQPK AKSQPRKETS ASVTTTLPDV TKEKPVTLAS IGIDAAQSVQ  300
PANVVGVTFC DDDRSSVMVN PSGPLDAIDA LHSEVAISDG NGDWNSSYGK STGENADIFS  360
GLEYLDDFLS QPATVTVSAA SKPQPQVNMN ALPGNKFLES YPVYTDAEGR LSPSEAQNLP  420
ASNNKDIGEE PEDQAGGRQA DVCKNDQDFQ IDNRRLQPEE VEAFSGLETL DILSKATLAS  480
GQHMGENPSQ SKLHTDKDKP SFDVPHPDTV ESVSCSQDAH LLPSETEYMD EDSIPAFPAG  540
EVLDFSSVRF SDSASTDPTY ELPVNNKDLA KSANLDAAAS GDVHSAGAGP KIPGSESSKG  600
RKRKTSTGSV LSQKGQKSST AVDKNETGKS SRRLRKRILT HELVDESEDE ARDNGAKPAE  660
PPINSVADED RNRDDECKVK NLSRKKRAPR KSMKSVAENE KPVRKRKNAN ETGDKSTKEP  720
PKKFSHSTRR KRRCVDKTLL ETPEDEIDPQ KLPIRDLIVL SEMRERMNKE ASSSKVPLAN  780
QSADDSYLHD SFDNGWETGA TEQARASNDD EENVRIQSSS HYINYQSYMD KTPTSRWSKS  840
DTELFYEAVQ QFGTDFSMIM QLFPGRTRNQ VKLKYKMEER KHPLRLFEAS TNRAKDHSHF  900
ELVIEQLKQV AAQEEQNSKQ ENSVGLTGVE EEMEEVTLET NEGATKSGQN EEGAVEEALA  960
EDKETDVAEF GPEKSDESDD DLYRWSQYKS EL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1684706KKRAPRKSMKSVAENEKPVRKRK
2700706KPVRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4359030.0AM435903.2 Vitis vinifera contig VV78X006414.13, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010645241.10.0PREDICTED: uncharacterized protein LOC100854024 isoform X1
TrEMBLF6I0M50.0F6I0M5_VITVI; Uncharacterized protein
STRINGVIT_03s0038g04460.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8075913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.13e-45MYB_related family protein