PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01022665001
Common NameVIT_02s0033g00460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 200aa    MW: 22905.3 Da    PI: 9.2087
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01022665001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.85.7e-143681148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg++  +E +l ++++k+lG++ W++Ia +++ gRt++++k++w+ ++
  GSVIVT01022665001 36 RGKFASDEVDLMIRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWHHHR 81
                       799999****************.*********.***********9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.925130IPR017877Myb-like domain
SuperFamilySSF466891.11E-171681IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-91642IPR009057Homeodomain-like
PROSITE profilePS5129421.3643185IPR017930Myb domain
SMARTSM007173.6E-103583IPR001005SANT/Myb domain
PfamPF002491.1E-113680IPR001005SANT/Myb domain
CDDcd001674.37E-84280No hitNo description
Gene3DG3DSA:1.10.10.608.9E-174380IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MEKKSGIWFP LRAGLSRCRK SCRLRWFNYL KPNIKRGKFA SDEVDLMIRL HKLLGNRWSL  60
IAGRLPGRTA NDVKNYWHHH RFRKMVPIQE KGKDKAQTNS ENTLIKPKPC KLFLGFTFKT  120
TAVDAYETQG STCSELQPTL VQPNQDILWW ESLFADHTIE DQELIASLLA DETASAVDTN  180
GGGNYDFPFE MGLIDEVMR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-15178540108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4420110.0AB442011.1 Vitis vinifera VvmybA3 gene for myb-related transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019081942.11e-150PREDICTED: transcription factor MYB75
SwissprotQ9FNV94e-40MY113_ARATH; Transcription factor MYB113
TrEMBLD7U3T21e-148D7U3T2_VITVI; Uncharacterized protein
STRINGVIT_02s0033g00460.t011e-149(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-42myb domain protein 113
Publications ? help Back to Top
  1. Li T, et al.
    Jasmonic acid enhancement of anthocyanin accumulation is dependent on phytochrome A signaling pathway under far-red light in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2014. 454(1): p. 78-83
    [PMID:25450360]
  2. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]