PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01022310001
Common NameLOC100242224, VIT_07s0031g02280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 222aa    MW: 24537.7 Da    PI: 7.2367
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01022310001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding315.8e-10114158347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT +E++l++ +   +G+g+W+ I r+   ++++ q+ s+ qky
  GSVIVT01022310001 114 PWTVQEHKLFLVGLIAFGKGDWRNILRHCVITKSPTQVASHAQKY 158
                        8***************************99889***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM0071712173IPR001005SANT/Myb domain
SuperFamilySSF466895.27E-62477IPR009057Homeodomain-like
PROSITE profilePS5129413.94107163IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-7108165IPR009057Homeodomain-like
SuperFamilySSF466891.27E-13109163IPR009057Homeodomain-like
SMARTSM007175.6E-7111161IPR001005SANT/Myb domain
TIGRFAMsTIGR015575.8E-13111161IPR006447Myb domain, plants
PfamPF002492.1E-8114158IPR001005SANT/Myb domain
CDDcd001677.29E-7114159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MEWSDFLESS FCTNLQALQT PHPGWDYEEN KMFETALAQL GFATPDLLQK VAARVPGKSF  60
EQVVSHFAAL VQDIEMIESA GDFPMSMPEL GTKKEQGSSA RAMSTGHTSR RGVPWTVQEH  120
KLFLVGLIAF GKGDWRNILR HCVITKSPTQ VASHAQKYFK RHSSSASSSA RRRRCSIHDI  180
QINFDDDSTS TILPNISQIS DASRLLPASC NNGEEKNPIS P*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}.
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4680890.0AM468089.2 Vitis vinifera contig VV78X149635.49, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002274908.21e-166PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-39DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A438F4V31e-165A0A438F4V3_VITVI; Transcription factor DIVARICATA
TrEMBLD7SWC91e-165D7SWC9_VITVI; Uncharacterized protein
STRINGVIT_07s0031g02280.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.23e-36MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]