PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01021086001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 373aa    MW: 40821.1 Da    PI: 8.1962
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01021086001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.5e-39106166262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  GSVIVT01021086001 106 EQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 166
                        6899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-29105164IPR003851Zinc finger, Dof-type
PfamPF027011.1E-33108164IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.525110164IPR003851Zinc finger, Dof-type
PROSITE patternPS013610112148IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MSFFLVIIFQ EINSETLLRF ICNAALSLSS FTSLSCSWIL NEGSSRHLLF VCLLFVSTIP  60
LRKEMLGNCE KMVVISSTTN DWPENQIDDK GLMASTGRVM EKPGQEQQAL KCPRCDSSNT  120
KFCYYNNYSL SQPRHFCKAC KRYWTRGGTL RNVPVGGGCR KNKRVKRPAS SVDAPSSAPT  180
AALNPPPPSQ IDLSASSNHV TPLFYGLPSN PSELNLPFPR FNSRASNEDT VSGYDLQPQL  240
GALGLGFSSG IIANDTRTDD YRNGFNPAKQ IQDLVTSSSL LSNYSIFGSS SSTTTPTMAS  300
LINSSLQQQK FMNGDLKESR GANHFQPLWN SVPCQNQIEQ IGSSDPSLYW NLTSLGAWSD  360
LPNMGSSVTS LI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4449320.0AM444932.2 Vitis vinifera contig VV78X179258.2, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003633022.20.0PREDICTED: dof zinc finger protein DOF1.4
TrEMBLF6HM250.0F6HM25_VITVI; Uncharacterized protein
STRINGVIT_10s0003g00040.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.12e-39Dof family protein