PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01021085001
Common NameLOC100246919, VIT_10s0003g00030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 300aa    MW: 32668 Da    PI: 9.3686
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01021085001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.82.4e-383390461
             zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         +kcprCds ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rk k++
  GSVIVT01021085001 33 LPQKCPRCDSINTKFCYYNNYSLSQPRYFCKTCRRYWTQGGTLRNVPVGGGCRKTKRK 90
                       5689***************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-253189IPR003851Zinc finger, Dof-type
PfamPF027013.7E-333589IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9473589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MQQDRDKGGG LEDVDPPDRR LKPAQSENQQ QQLPQKCPRC DSINTKFCYY NNYSLSQPRY  60
FCKTCRRYWT QGGTLRNVPV GGGCRKTKRK PSASGDNSRS QLPTQQQQQN LAAPPPNIIS  120
TNSGVAVGPA LRIAEPANLS PAPAPASAPT LSSVNPYYPA GAFLSSLPAM RPLNQPQPQP  180
FNQPVNVGRD FGGSNLAILQ GFNVPSLGSQ QQQRQQAEFY QMGNRDRNIE SLYGSGEDLI  240
QSSRPTGHQN NWHQTFINPT APDSNLWSIG GSSNNNSNAA SSSFNQNHWA DLQGYGPPP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4311270.0AM431127.2 Vitis vinifera contig VV78X089476.28, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002274050.10.0PREDICTED: dof zinc finger protein DOF5.7
RefseqXP_019077995.10.0PREDICTED: dof zinc finger protein DOF5.7
TrEMBLA0A438DR470.0A0A438DR47_VITVI; Dof zinc finger protein DOF5.3
TrEMBLD7TJB70.0D7TJB7_VITVI; Uncharacterized protein
STRINGVIT_10s0003g00030.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-34TARGET OF MONOPTEROS 6