PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01020353001
Common NameLOC100252484, VIT_19s0027g01120, VITISV_026098
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 171aa    MW: 18763.2 Da    PI: 7.4609
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01020353001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260147.92.6e-46131121100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lpe++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l++
  GSVIVT01020353001  13 PCAACKLLRRRCAQDCVFAPYFPADEPHKFASVHKVFGASNVNKMLQELPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDALQT 104
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +lal+++e
  GSVIVT01020353001 105 QLALVQAE 112
                        ****9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.35212113IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MKESGRKQGA VSPCAACKLL RRRCAQDCVF APYFPADEPH KFASVHKVFG ASNVNKMLQE  60
LPEHQRSDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID ALQTQLALVQ AEVVQMRMNQ  120
FTSSTSNQAT DSPENASHTS RLAASPQTKS FFSMDMVVDH ANMVESLWSY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-5091217119LOB family transfactor Ramosa2.1
5ly0_B3e-5091217119LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.151430.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4630150.0AM463015.2 Vitis vinifera contig VV78X121155.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002264049.21e-125PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE91e-71LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA5BKW91e-124A5BKW9_VITVI; Uncharacterized protein
STRINGVIT_19s0027g01120.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.15e-74LOB domain-containing protein 4
Publications ? help Back to Top
  1. Velasco R, et al.
    A high quality draft consensus sequence of the genome of a heterozygous grapevine variety.
    PLoS ONE, 2007. 2(12): p. e1326
    [PMID:18094749]