PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01020132001
Common NameLOC100253576, VIT_01s0026g01050, VITISV_028723
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 301aa    MW: 32386.2 Da    PI: 10.0734
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01020132001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.1e-1487131347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE+ l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  GSVIVT01020132001  87 PWTEEEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 131
                        8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.763520IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.37780136IPR017930Myb domain
SuperFamilySSF466893.66E-1782137IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-1783134IPR006447Myb domain, plants
SMARTSM007171.6E-1084134IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-1186131IPR009057Homeodomain-like
CDDcd001671.61E-987132No hitNo description
PfamPF002494.9E-1187131IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MSRSCSQCGN NGHNSRTCTE SGGAGAAAND IMLFGVRITE GAFRKSASMT NLSQYEQPQD  60
SNADAGYASD DVVHASARSR ERKRGVPWTE EEHRLFLLGL QKVGKGDWRG ISRNFVKTRT  120
PTQVASHAQK YFLRRNNHNR RRRRSSLFDI TADTFMGSTI LEEDQVHQET VSPPQLHSHL  180
NGSAGGFPVP TFPVTMAPVV LPVASNGSME ILTLGQSNQA KGPTKLIRPI PILPVPPSSK  240
MADLNLNIPS TADPLPLSLK PSSSTSTSPQ SPTATRHSSA FQAMSESFNS STGDNIISVA  300
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.244210.0inflorescence| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates during leaf expansion. First observed at the tip of the leaves 12 days after sowing (DAS). At 14 DAS, expressed throughout the leaf blade to fade out thereafter in a basipetal manner. In mature leaves, detected in vascular tissue, especially in companion cells (PubMed:24806884). Accumulates to higher levels in old rosette leaves than in young rosette and cauline leaves (PubMed:25920996). {ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}.
UniprotTISSUE SPECIFICITY: Expressed ubiquitously, except in hypocotyls, root tips and lateral root primordia. {ECO:0000269|PubMed:25920996}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00630PBMTransfer from PK17526.1Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3812330.0FQ381233.1 Vitis vinifera clone SS0ACG1YA07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010652808.10.0PREDICTED: transcription factor MYB1R1
SwissprotQ9LVS08e-63KUA1_ARATH; Transcription factor KUA1
TrEMBLA5C6310.0A5C631_VITVI; Uncharacterized protein
STRINGVIT_01s0026g01050.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.24e-78MYB_related family protein
Publications ? help Back to Top
  1. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]