PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01020078001
Common NameLOC100241577, VIT_01s0026g01550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 322aa    MW: 36429.6 Da    PI: 4.5747
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01020078001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.45e-1886139356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k++++t+ q++ Le+ Fe ++++  e++ +LAk+lgL+ rqV +WFqNrRa+ k
  GSVIVT01020078001  86 KKRRLTAGQVQFLERNFEVENKLEPERKNQLAKELGLQPRQVAIWFQNRRARFK 139
                        56689***********************************************98 PP

2HD-ZIP_I/II125.72.1e-4085175191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        ekkrrl++ qv++LE++Fe e+kLeperK++la+eLglqprqva+WFqnrRAR+ktkqlEkdy++Lk++yd+lk++ + + ke+e+L++el
  GSVIVT01020078001  85 EKKRRLTAGQVQFLERNFEVENKLEPERKNQLAKELGLQPRQVAIWFQNRRARFKTKQLEKDYDSLKASYDSLKADYDCILKEKEKLKTEL 175
                        69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.99E-1876143IPR009057Homeodomain-like
PROSITE profilePS5007117.34681141IPR001356Homeobox domain
SMARTSM003892.7E-1684145IPR001356Homeobox domain
CDDcd000864.81E-1686142No hitNo description
PfamPF000461.9E-1586139IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.6E-1987149IPR009057Homeodomain-like
PRINTSPR000316.5E-6112121IPR000047Helix-turn-helix motif
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
PRINTSPR000316.5E-6121137IPR000047Helix-turn-helix motif
PfamPF021832.4E-15141181IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MDGRKLYGGG SNMAVLLRKE TLPSPSELLE SFWIPDSSTT FHGSKSVVNF EGVGGDDTKD  60
RPFFQTLHEE ENGDEDFEGC FHRPEKKRRL TAGQVQFLER NFEVENKLEP ERKNQLAKEL  120
GLQPRQVAIW FQNRRARFKT KQLEKDYDSL KASYDSLKAD YDCILKEKEK LKTELLLLTD  180
KALIGEKEGE KTKALENISP SHAESQKAIP NRVSEHVPPN APILFCKQED ASSAKSDVFD  240
SDSPLYTDGN HSSLLEPADS SQIFEPDQSE FSQDEEDNLS KSLIPPLCFP KLEDCSYPDP  300
PANACNLGLP AEEQPFWFWS Y*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141RRARFKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.50030.0bud| cell culture| fruit| inflorescence| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4677870.0AM467787.2 Vitis vinifera contig VV78X266807.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002269605.20.0PREDICTED: homeobox-leucine zipper protein HAT5
TrEMBLA0A438D7550.0A0A438D755_VITVI; Homeobox-leucine zipper protein HAT5
TrEMBLD7TNF10.0D7TNF1_VITVI; Uncharacterized protein
STRINGVIT_01s0026g01550.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.16e-40homeobox 1