PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01019722001
Common NameLOC100247896, VIT_02s0025g03220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Trihelix
Protein Properties Length: 498aa    MW: 54584.3 Da    PI: 9.4251
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01019722001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix98.46.4e-31102186187
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                        rW++qe+laL+++r+em+ ++r++ lk+plWe+vs+k++e g++rs+k+Ckek+en++k+yk++keg+ +r++++s  +++f+qlea
  GSVIVT01019722001 102 RWPRQETLALLKIRSEMDVAFRDATLKGPLWEDVSRKLAELGYSRSAKKCKEKFENVHKYYKRTKEGRAGRQDGKS--YRFFSQLEA 186
                        8*********************************************************************866665..*******85 PP

2trihelix109.91.6e-34343428187
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                        rW+k evlaLi++r+ +++r++++  k+plWee+s+ m++ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+ +tcpyf+ql+a
  GSVIVT01019722001 343 RWPKTEVLALINLRSGLDSRYQEAGPKGPLWEEISAGMQQMGYKRSAKRCKEKWENINKYFKKVKESNKKR-PEDAKTCPYFHQLDA 428
                        8*********************************************************************8.99999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007179.9E-499161IPR001005SANT/Myb domain
CDDcd122039.04E-28101166No hitNo description
PfamPF138374.1E-21101187No hitNo description
PROSITE profilePS500906.841101159IPR017877Myb-like domain
PROSITE profilePS500906.946336400IPR017877Myb-like domain
SMARTSM007170.0084340402IPR001005SANT/Myb domain
PfamPF138378.7E-24342429No hitNo description
CDDcd122032.74E-31343407No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0009414Biological Processresponse to water deprivation
GO:0010090Biological Processtrichome morphogenesis
GO:0030308Biological Processnegative regulation of cell growth
GO:0032876Biological Processnegative regulation of DNA endoreduplication
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000037Biological Processregulation of stomatal complex patterning
GO:2000038Biological Processregulation of stomatal complex development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MQQGGSQYGV SSEMTPFAAT TTTTSTRTHV LGGADQQQQQ LKLGDPTLAV AEEASPISSR  60
PPAHSSAGNF DEFLPVGGGL PDEDALAAGD EGDRGGVASG NRWPRQETLA LLKIRSEMDV  120
AFRDATLKGP LWEDVSRKLA ELGYSRSAKK CKEKFENVHK YYKRTKEGRA GRQDGKSYRF  180
FSQLEALHST ATSNVNPMPV SSVRIPSASP STMGASPMFP PDLSSGMITA PSGSAAATAP  240
AAAPTHTALG ISFSSNTSNS RRMMDFFESL MKQVMEKQEV MQQRFLETIE KREQDRMIRE  300
EAWKRQEMAR LPTGTLVMAI PEQQVPPQDI SSGGGSLESS SSRWPKTEVL ALINLRSGLD  360
SRYQEAGPKG PLWEEISAGM QQMGYKRSAK RCKEKWENIN KYFKKVKESN KKRPEDAKTC  420
PYFHQLDALY RKKLLGSTSG SGGSGGSTYV NPNRPEEQQQ QQPPPQHESA KLDPIPTPYS  480
QDRAALLGEE LRSQKTL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.17820.0bud| cell culture| fruit| inflorescence| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4686260.0AM468626.1 Vitis vinifera contig VV78X207150.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010660505.11e-180PREDICTED: trihelix transcription factor GTL1 isoform X2
RefseqXP_010660510.11e-180PREDICTED: trihelix transcription factor GTL1 isoform X3
TrEMBLF6HUB01e-178F6HUB0_VITVI; Uncharacterized protein
STRINGVIT_02s0025g03220.t011e-179(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-60Trihelix family protein