PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01019655001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 223aa    MW: 25925 Da    PI: 5.067
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01019655001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.93.6e-184598356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       ++++f++eq++ Le lFe++  p a+ +++ A++lgL  rqV +WFqN+Ra+ k
  GSVIVT01019655001 45 RKRKFSEEQIRSLEFLFESEARPEAQLKQKVASELGLHPRQVAIWFQNKRARSK 98
                       4569************************************************99 PP

2HD-ZIP_I/II106.71.8e-3445136293
        HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                        +kr++s+eq+++LE  Fe+e + e + K+++a+eLgl+prqva+WFqn+RAR k+kq+E+dy++Lk++yd+l+ + e+Leke+++L+ +l++
  GSVIVT01019655001  45 RKRKFSEEQIRSLEFLFESEARPEAQLKQKVASELGLHPRQVAIWFQNKRARSKSKQIEQDYAVLKASYDNLALQFESLEKENQNLAIQLQR 136
                        8**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.26E-1535101IPR009057Homeodomain-like
PROSITE profilePS5007116.82740100IPR001356Homeobox domain
SMARTSM003892.3E-1443104IPR001356Homeobox domain
CDDcd000862.62E-1243101No hitNo description
PfamPF000462.1E-154598IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-1547107IPR009057Homeodomain-like
PROSITE patternPS0002707598IPR017970Homeobox, conserved site
PfamPF021832.1E-16100140IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MHVSAASIFC LSNFPVFFLF LFTFEEYFPA METSENIATS IRKIRKRKFS EEQIRSLEFL  60
FESEARPEAQ LKQKVASELG LHPRQVAIWF QNKRARSKSK QIEQDYAVLK ASYDNLALQF  120
ESLEKENQNL AIQLQRLRDG LEKPRGKEDE ESEIGYTNSE TKERYNPVLQ GRIEYFAEDT  180
HTPKMEEQTN SSLTSSADLG IFKSSCFQDQ SNCSSQWWEL WS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.88051e-81bud| fruit| inflorescence| pedicel
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4681400.0AM468140.2 Vitis vinifera contig VV78X154850.11, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002280048.11e-139PREDICTED: homeobox-leucine zipper protein ATHB-12
TrEMBLA0A438BV811e-137A0A438BV81_VITVI; Homeobox-leucine zipper protein ATHB-12
TrEMBLF6HU741e-137F6HU74_VITVI; Uncharacterized protein
STRINGVIT_02s0025g02590.t011e-138(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61890.15e-38homeobox 12