PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01019619001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 143aa    MW: 15911.9 Da    PI: 9.8967
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01019619001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1291.3e-403697263
             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                       ke+al+cprC+stntkfCyynnyslsqPryfCkaCrryWt+GG+lrn+PvGgg+rknk+sss
  GSVIVT01019619001 36 KEQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKACRRYWTEGGSLRNIPVGGGSRKNKRSSS 97
                       7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-302994IPR003851Zinc finger, Dof-type
PfamPF027011.5E-343894IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2364094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MDTAQWPQEI VVKPLEEIVT NTCPKPALEK RARPQKEQAL NCPRCNSTNT KFCYYNNYSL  60
SQPRYFCKAC RRYWTEGGSL RNIPVGGGSR KNKRSSSSSS SSSSSASSKK LPDLPLKISE  120
VFGAAHWDHF KGVEFLHAHA NS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.84790.0fruit| inflorescence| pedicel
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at preprocambial stages first in wide domains, and later confined to sites of vein development. {ECO:0000269|PubMed:20563990}.
UniprotTISSUE SPECIFICITY: Accumulates in the stele. {ECO:0000269|PubMed:20563990}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4881311e-178AM488131.2 Vitis vinifera contig VV78X232223.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002262703.12e-78PREDICTED: dof zinc finger protein DOF4.6
SwissprotQ8LAP86e-55DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLF6HU586e-77F6HU58_VITVI; Uncharacterized protein
STRINGVIT_02s0025g02250.t019e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.13e-56Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]