PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01019012001
Common NameLOC100253069, VIT_04s0023g01330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 212aa    MW: 24353.4 Da    PI: 6.3755
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01019012001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.5e-1954106456
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        ++++++eq++ Le  F +++++  e++ ++A++lgL+ rqV vWFqNrRa++k
  GSVIVT01019012001  54 KRKLSEEQVTHLELNFGNEHKLESERKDKIASELGLDPRQVAVWFQNRRARWK 106
                        45899***********************************************9 PP

2HD-ZIP_I/II116.51.5e-3753144293
        HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                        +kr+ls+eqv+ LE +F +e+kLe+erK ++a+eLgl+prqvavWFqnrRAR+k+k+lE+++++Lk  +++++ e++rLe+ev +L+e+l++
  GSVIVT01019012001  53 RKRKLSEEQVTHLELNFGNEHKLESERKDKIASELGLDPRQVAVWFQNRRARWKSKKLEEEFSKLKIVHESVVVEKCRLETEVLTLKEQLSD 144
                        8***************************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.1848108IPR001356Homeobox domain
SMARTSM003891.0E-1551112IPR001356Homeobox domain
SuperFamilySSF466893.07E-1651109IPR009057Homeodomain-like
CDDcd000863.52E-1553109No hitNo description
PfamPF000462.3E-1654106IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.3E-1955114IPR009057Homeodomain-like
PRINTSPR000312.1E-57988IPR000047Helix-turn-helix motif
PROSITE patternPS00027083106IPR017970Homeobox, conserved site
PRINTSPR000312.1E-588104IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MTTAMNQQVQ DHMELFTHMY PGLYTQAMPE QGEAKVRRRR KKSKGESSSG CARKRKLSEE  60
QVTHLELNFG NEHKLESERK DKIASELGLD PRQVAVWFQN RRARWKSKKL EEEFSKLKIV  120
HESVVVEKCR LETEVLTLKE QLSDAEKEIR RLSERSDGVS SNSPTSSLSN AVDVDPPFFG  180
EFGVVDGLDN VFYIPENNYV SGMEWGYLYD M*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13755RRRKKSKGESSSGCARKRK
23955RKKSKGESSSGCARKRK
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, flowers and siliques. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00473DAPTransfer from AT4G36740Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4870781e-171AM487078.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X059360.5, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273007.11e-157PREDICTED: homeobox-leucine zipper protein ATHB-40
SwissprotO232083e-71ATB40_ARATH; Homeobox-leucine zipper protein ATHB-40
TrEMBLA0A438GP801e-156A0A438GP80_VITVI; Homeobox-leucine zipper protein ATHB-40
TrEMBLD7SPI21e-156D7SPI2_VITVI; Uncharacterized protein
STRINGVIT_04s0023g01330.t011e-157(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP37761025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.12e-56homeobox protein 40
Publications ? help Back to Top
  1. González-Grandío E, et al.
    Abscisic acid signaling is controlled by a BRANCHED1/HD-ZIP I cascade in Arabidopsis axillary buds.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(2): p. E245-E254
    [PMID:28028241]