PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01018486001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 224aa    MW: 24587.4 Da    PI: 7.8304
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01018486001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.16.3e-4371061100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk++rrkC+++C++apyfp +qp+kfanvhk+FGasnv kll++++  +reda++sl+yeAear++dPvyG+vg+i+ lqqql++l++
  GSVIVT01018486001   7 PCAACKLQRRKCTQECIYAPYFPPDQPQKFANVHKVFGASNVAKLLNEINAANREDAVNSLAYEAEARLHDPVYGCVGMISILQQQLKHLQN 98 
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +l ++k+e
  GSVIVT01018486001  99 DLLAAKKE 106
                        *9998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4366107IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-427103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MSSSNSPCAA CKLQRRKCTQ ECIYAPYFPP DQPQKFANVH KVFGASNVAK LLNEINAANR  60
EDAVNSLAYE AEARLHDPVY GCVGMISILQ QQLKHLQNDL LAAKKELAAY IGPSAMAHVG  120
YMPQQYMSDP SSSSVIPYNM SPILGLPPGA PHGGQLIIHF AFLNCSDPMH LILYRRITVG  180
YWQLPSLHFH CGQGPFISAL THKVGKDAMI MVFEAAYFFG ETL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-4841238123LOB family transfactor Ramosa2.1
5ly0_B7e-4841238123LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in trichomes, at the base of many lateral organs, including branching points of the inflorescence and floral organs and in the distal part of the pistil at stages when style and stigma start to develop. Also detected in pedicels and at the base of petals and sepals. {ECO:0000269|PubMed:15821980}.
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4874050.0AM487405.1 Vitis vinifera contig VV78X136265.5, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010662454.11e-112PREDICTED: protein LATERAL ORGAN BOUNDARIES
SwissprotQ9FKZ33e-61LBD36_ARATH; LOB domain-containing protein 36
TrEMBLF6HAJ31e-111F6HAJ3_VITVI; Uncharacterized protein
STRINGVIT_16s0022g02050.t011e-112(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-63ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]