PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01018247001
Common NameLOC100264963, VIT_15s0021g01880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 293aa    MW: 32757.9 Da    PI: 6.71
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01018247001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.7e-18119173256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++keq  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  GSVIVT01018247001 119 RKKLRLSKEQSAILEETFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 173
                        678899***********************************************98 PP

2HD-ZIP_I/II1284e-41119208191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        +kk+rlskeq+++LEe+F+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  GSVIVT01018247001 119 RKKLRLSKEQSAILEETFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTEENRRLQKEVQELR-TL 208
                        69*************************************************************************************9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.5E-17892IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466895.56E-19110176IPR009057Homeodomain-like
PROSITE profilePS5007117.216115175IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.8E-18117178IPR009057Homeodomain-like
SMARTSM003896.1E-15117179IPR001356Homeobox domain
PfamPF000465.9E-16119173IPR001356Homeobox domain
CDDcd000865.87E-16119176No hitNo description
PROSITE patternPS000270150173IPR017970Homeobox, conserved site
SMARTSM003402.6E-26175218IPR003106Leucine zipper, homeobox-associated
PfamPF021836.0E-11175208IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MEENEFWMVD KDDDLGLSLA LKCPEALPQR PLNLFVQKKA LCSDAFHASE TRAYLRGIDV  60
NRAPTMADCE DVGVSSPNST ISSISGKRND RETNEEENEN ENEIESSEED AGGTGDTVRK  120
KLRLSKEQSA ILEETFKEHN TLNPKQKLAL AKQLNLRPRQ VEVWFQNRRA RTKLKQTEVD  180
CEYLKRCCEN LTEENRRLQK EVQELRTLKL SPQLYMHMNP PTTLTMCPSC ERVAVASASS  240
SAPSPSPASN PLAAAPHFPL GPHQHRPMPI AGPWAGAASM RHRPFDAHGT RS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1167175RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4318840.0AM431884.1 Vitis vinifera contig VV78X126512.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661380.10.0PREDICTED: homeobox-leucine zipper protein HAT4
SwissprotP466027e-90HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A438DA130.0A0A438DA13_VITVI; Homeobox-leucine zipper protein HAT3
TrEMBLF6GV910.0F6GV91_VITVI; Uncharacterized protein
STRINGVIT_15s0021g01880.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.15e-70homeobox protein 2
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]
  3. Caggiano MP, et al.
    Cell type boundaries organize plant development.
    Elife, 2018.
    [PMID:28895530]