PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01017073001
Common NameVIT_09s0002g04340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 751aa    MW: 82959 Da    PI: 6.3791
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01017073001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.2e-2195150156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        r+k +++t+eq++e+e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  GSVIVT01017073001  95 RKKYHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIK 150
                        7999************************************************9877 PP

2START232.41.2e-722664892206
                        HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
              START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                        + ++a++el k+a+a+ep+W +s+    e++n+de++++f+ +++      +s+ea+r++gvv+ +l++lv++++d++ qW+e+++    ka
  GSVIVT01017073001 266 IVNQAMEELKKMATAGEPLWIRSVetgrEILNYDEYMREFSVENSgngrpkRSIEASRETGVVFVDLPRLVQSFMDVN-QWKEMFPctisKA 356
                        56789***********************************8888799*******************************.************* PP

                        EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
              START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                        +t++ i++g      ga+qlm+aelq+l+p+vp R+++fvR+++ql+a++w+ivdvS+d  +++  ++s+v+++++pSg++ie+ksngh+kv
  GSVIVT01017073001 357 ATVDIICNGegpnrnGAVQLMFAELQMLTPMVPtREVYFVRFCKQLSADQWAIVDVSIDKVEDNI-DASLVKCRKRPSGCIIEDKSNGHCKV 447
                        ***************************************************************98.9************************* PP

                        EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        +wveh +++++++h ++r++v+sgla+gak+w atlq qce+
  GSVIVT01017073001 448 IWVEHLECQKSTVHTMYRQIVNSGLAFGAKHWIATLQLQCER 489
                        ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-2380146IPR009057Homeodomain-like
SuperFamilySSF466891.58E-2087153IPR009057Homeodomain-like
PROSITE profilePS5007118.2292152IPR001356Homeobox domain
SMARTSM003898.3E-1994156IPR001356Homeobox domain
PfamPF000461.0E-1895150IPR001356Homeobox domain
CDDcd000865.71E-1799150No hitNo description
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
PROSITE profilePS5084839.722256492IPR002913START domain
SuperFamilySSF559612.2E-33258489No hitNo description
CDDcd088752.64E-114260488No hitNo description
Gene3DG3DSA:3.30.530.204.8E-5263484IPR023393START-like domain
SMARTSM002349.3E-73265489IPR002913START domain
PfamPF018524.5E-58266489IPR002913START domain
SuperFamilySSF559611.65E-15519736No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MSNPPASRTK DFFASPALSL SLAGIFRDGG AAAAAAANME VEEGDEGSGG GRRDDTVEIS  60
SENSGPARSR SEDEFDGEGE GDEDGEGEKG KKKKRKKYHR HTAEQIREME ALFKESPHPD  120
EKQRQQLSKQ LGLAPRQVKF WFQNRRTQIK AIQERHENSL LKSEMEKLRD ENKAMRETIK  180
KSCCPNCGSA TSSRDPTMTT EEQQLRIENA RLKAEVEKLR AVIGKYPPGT GSPSSSCSAG  240
NDHENRSSLE FYTGIFGLEK SRIMEIVNQA MEELKKMATA GEPLWIRSVE TGREILNYDE  300
YMREFSVENS GNGRPKRSIE ASRETGVVFV DLPRLVQSFM DVNQWKEMFP CTISKAATVD  360
IICNGEGPNR NGAVQLMFAE LQMLTPMVPT REVYFVRFCK QLSADQWAIV DVSIDKVEDN  420
IDASLVKCRK RPSGCIIEDK SNGHCKVIWV EHLECQKSTV HTMYRQIVNS GLAFGAKHWI  480
ATLQLQCERL VFFMATNVPT KDSSGVATLA GRKSILKLAQ RMTWSFCRAL GASSFNSWTK  540
VSSKTGDDIR VASRKNLNDP GEPQGVILCA VSSVWLPVAP HVIFDFLRDE ARRSEWDIML  600
SGGPVQSIAN LAKGQDRGNA VTIQTMKSKD NSMWVVQDTC TNAYESMVVY APVDIPGMQS  660
VMTGCDSSSI AILPSGFSIL PDGVESRPLV ITSRPEEKST EGGSLLTIAF QVLTNTSPTA  720
KLTMESVESV NTLVSCTLQN IKTSLQCEDG *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19095KKKKRK
29096KKKKRKK
39296KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.63420.0bud| fruit| inflorescence| pedicel
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing trichomes.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required for correct morphological development and maturation of trichomes as well as for normal development of seed coat mucilage. Regulates the frequency of trichome initiation and determines trichome spacing. {ECO:0000269|PubMed:11844112}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by GEM. {ECO:0000269|PubMed:17450124}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3932680.0FQ393268.1 Vitis vinifera clone SS0AFA26YN18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284502.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLD7U0I30.0D7U0I3_VITVI; Uncharacterized protein
STRINGVIT_09s0002g04340.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9080913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Wu R,Citovsky V
    Adaptor proteins GIR1 and GIR2. I. Interaction with the repressor GLABRA2 and regulation of root hair development.
    Biochem. Biophys. Res. Commun., 2017. 488(3): p. 547-553
    [PMID:28526410]