PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01016887001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 240aa    MW: 27450.6 Da    PI: 8.4491
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01016887001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.63.7e-401676262
             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                       ++++lkcprC+stntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+PvGgg+rkn k+s
  GSVIVT01016887001 16 EQEHLKCPRCESTNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGSRKNTKRS 76
                       57899****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-28672IPR003851Zinc finger, Dof-type
PfamPF027012.1E-331874IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4322074IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102258IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MQDPSTFQPM KTHFPEQEHL KCPRCESTNT KFCYYNNYNL SQPRHFCKNC RRYWTKGGAL  60
RNIPVGGGSR KNTKRSSNPK RPSSSSSTTE ECSTSAEVSA LSWPRTANSE ACWRILEIQS  120
RYSSSSMFPH CLKRARQGST SPSFWILFFI IAMLFFHLFG CQDSHTCLEF IFDLFLCSQM  180
VHPCNLWMDL CMGYTQSIVK IIELVFHVHV GTFACCFFRV VEGIAIFHGV DHIPMVFGC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.106201e-127leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4760360.0AM476036.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X057671.24, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010267036.11e-56PREDICTED: dof zinc finger protein DOF3.1-like
TrEMBLA0A1U8ALW52e-55A0A1U8ALW5_NELNU; dof zinc finger protein DOF3.1-like
STRINGXP_010267036.14e-56(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-37DOF zinc finger protein 1