PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01016538001
Common NameLOC100258172, VIT_13s0019g01410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 338aa    MW: 35456.6 Da    PI: 9.0847
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01016538001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.7e-3972132262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +e+alkcprC+stntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+nk+s+
  GSVIVT01016538001  72 PETALKCPRCESTNTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKRSK 132
                        67899*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-2959121IPR003851Zinc finger, Dof-type
PfamPF027016.7E-3375130IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.64676130IPR003851Zinc finger, Dof-type
PROSITE patternPS01361078114IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MVFSSVPVYL DPPNWQQQAN HQPGGSNDNP HLPPQQAPPP LPPVGGGGSG GTGTIRPGSM  60
ADRARLAKLP QPETALKCPR CESTNTKFCY FNNYSLSQPR HFCKACRRYW TRGGALRNVP  120
VGGGCRRNKR SKGNRSKSPV TGERQGGSSS ASAVPSNSCT SDMIGHLPPP PPPPQLSFLP  180
PLHHLADYGA GDIGLNFGGI QPPVAVSGGG NSGTDIEFPI GSCSGGGGPI LSGGLAEHWR  240
LQQVQQFPFL AGLEPPSGLY SFEGEGTEPP SYLGGSGHLR AKALDSGVTQ MTAVKIEENQ  300
GLNLSRNFLG LPGNDQYWSG NTWNDLSGSV KAKSAQR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4767240.0AM476724.2 Vitis vinifera contig VV78X088874.5, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010658563.10.0PREDICTED: dof zinc finger protein DOF3.6 isoform X2
TrEMBLD7TLT50.0D7TLT5_VITVI; Uncharacterized protein
STRINGVIT_13s0019g01410.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.13e-38OBF-binding protein 3