PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01016335001
Common NameLOC100259896, VIT_13s0019g03700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 198aa    MW: 21757.8 Da    PI: 5.7482
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01016335001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.71.7e-4242140199
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++kll++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a
  GSVIVT01016335001  42 PCAACKILRRRCADKCVLAPYFPPTEPLKFTIAHRVFGASNIIKLLQDLPESQRADAVSSMVYEANARIRDPVYGCAGAICHLQKQVSELQA 133
                        7******************************************************************************************* PP

             DUF260  93 elallke 99 
                        +la++++
  GSVIVT01016335001 134 QLAKAQA 140
                        ***9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.79441142IPR004883Lateral organ boundaries, LOB
PfamPF031956.3E-4342139IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MESAENNKAP GTTVSTPLPF SPTSSSNSGL PRSPPALVVL SPCAACKILR RRCADKCVLA  60
PYFPPTEPLK FTIAHRVFGA SNIIKLLQDL PESQRADAVS SMVYEANARI RDPVYGCAGA  120
ICHLQKQVSE LQAQLAKAQA DVINMQCQQD NLVAILCMDF QQQQQQPQYQ QQQQQPFEFN  180
GSFFLEDGNL VMEPLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-424114910118LOB family transfactor Ramosa2.1
5ly0_B3e-424114910118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4303090.0AM430309.2 Vitis vinifera contig VV78X081633.37, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010658441.11e-144PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR08e-75LBD1_ARATH; LOB domain-containing protein 1
TrEMBLD7TME51e-143D7TME5_VITVI; Uncharacterized protein
STRINGVIT_13s0019g03700.t011e-144(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-73LOB domain-containing protein 1