PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01016334001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 191aa    MW: 21159.1 Da    PI: 6.51
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01016334001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.45.5e-39571561100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+C+++ +lapyfp +++ kf ++hk+FGasn++k l++lpe+ r da+ss+vyeA+ar+rdPvyG++g i++lq++l+ l++
  GSVIVT01016334001  57 PCAACKILRRRCTDKGMLAPYFPPTETLKFIIAHKVFGASNIVKSLQELPESMRADAVSSMVYEAKARIRDPVYGCAGAINQLQKELRDLQT 148
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        ela++++ 
  GSVIVT01016334001 149 ELAATQAD 156
                        ***99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508912456157IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-3857154IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MIFIHYTFMG RNGRDNGKRE SEIDEMEYTD PTTTGSTIDP SSSSRLAASL PTAVKGPCAA  60
CKILRRRCTD KGMLAPYFPP TETLKFIIAH KVFGASNIVK SLQELPESMR ADAVSSMVYE  120
AKARIRDPVY GCAGAINQLQ KELRDLQTEL AATQADLAII RCQQQQLQLN DSMSFPEQSN  180
LGSPWESYWN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-385716411118LOB family transfactor Ramosa2.1
5ly0_B2e-385716411118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4630551e-140AM463055.1 Vitis vinifera contig VV78X178974.2, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275345.11e-121PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR05e-52LBD1_ARATH; LOB domain-containing protein 1
TrEMBLF6HNJ81e-119F6HNJ8_VITVI; Uncharacterized protein
STRINGVIT_13s0019g03710.t011e-120(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-54LOB domain-containing protein 1