PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01016333001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 280aa    MW: 30856.3 Da    PI: 7.0022
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01016333001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.11.7e-39311301100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+C++ Cvlapyfp ++p +f ++h++FGasn++k +++lpe++r da+ss++yeA++r+ dPvyG++g i++l++ql+ l++
  GSVIVT01016333001  31 PCAACKILRRRCTDRCVLAPYFPPTEPFNFIIAHRVFGASNIIKSVQDLPESRRADAVSSMIYEANVRMCDPVYGCAGAISQLHKQLCDLQT 122
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        ela++++e
  GSVIVT01016333001 123 ELAATQAE 130
                        ****9987 PP

2DUF260131.53.5e-411462451100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+C++ Cvlapyfp ++p kf ++hk+FGasn++k l++lpe++r da+ss+vyeA ar rdPvyG++g i++lq+ql+ l+a
  GSVIVT01016333001 146 PCAACKILRRRCTERCVLAPYFPPTEPLKFVIAHKVFGASNIVKALQELPESKRADAVSSMVYEAYARNRDPVYGCAGAISHLQKQLNDLQA 237
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        ela++++ 
  GSVIVT01016333001 238 ELAMTQAA 245
                        ***99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.90630131IPR004883Lateral organ boundaries, LOB
PfamPF031958.7E-3931128IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089125.473145246IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-41146243IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MEYTDPTTTG STIPSSSSSL APSLPTAVQR PCAACKILRR RCTDRCVLAP YFPPTEPFNF  60
IIAHRVFGAS NIIKSVQDLP ESRRADAVSS MIYEANVRMC DPVYGCAGAI SQLHKQLCDL  120
QTELAATQAE LAIVQCQQQQ LNESGPCAAC KILRRRCTER CVLAPYFPPT EPLKFVIAHK  180
VFGASNIVKA LQELPESKRA DAVSSMVYEA YARNRDPVYG CAGAISHLQK QLNDLQAELA  240
MTQAALLLIQ CQQHEQNHEN TAIFDQDKYF SSVLEPSWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-39212532118LOB family transfactor Ramosa2.1
5ly0_B2e-39212532118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4555101e-147AM455510.1 Vitis vinifera contig VV78X165644.5, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010658439.19e-97PREDICTED: LOB domain-containing protein 1
SwissprotQ9SK082e-53LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A2H5NZ651e-103A0A2H5NZ65_CITUN; Uncharacterized protein
STRINGVIT_13s0019g03750.t013e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.12e-55LOB domain-containing protein 11