PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01016332001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 166aa    MW: 18224.8 Da    PI: 8.1073
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01016332001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.77e-42411401100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCkvlrr+C++ C lapyfp +++ kf ++hk+FGasn++k l++lpe++r da+ss+vyeA++r++dPvyG++g i+klq+ql+ l+a
  GSVIVT01016332001  41 PCAACKVLRRRCTDTCSLAPYFPPSEQLKFVIAHKVFGASNIVKALQELPESKRADAVSSMVYEANVRIHDPVYGCAGAISKLQKQLNDLQA 132
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        ela++++e
  GSVIVT01016332001 133 ELAVTQAE 140
                        ****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.08640141IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-4141138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MEYTNKTRRS LRVSTPFSFS SSSYSPSLMP SPSLPTVVQG PCAACKVLRR RCTDTCSLAP  60
YFPPSEQLKF VIAHKVFGAS NIVKALQELP ESKRADAVSS MVYEANVRIH DPVYGCAGAI  120
SKLQKQLNDL QAELAVTQAE LLIMQCQQQQ QNDIASFYDR DLGSD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-414114811118LOB family transfactor Ramosa2.1
5ly0_B6e-414114811118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
UniprotTISSUE SPECIFICITY: Expressed in young shoots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4295911e-141AM429591.2 Vitis vinifera contig VV78X052699.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275182.21e-120PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR08e-54LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK083e-53LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A438CGW81e-118A0A438CGW8_VITVI; LOB domain-containing protein 1
STRINGVIT_13s0019g03760.t011e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.15e-54LOB domain-containing protein 11