PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01016330001
Common NameLOC100256462, VIT_13s0019g03780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 174aa    MW: 19074.6 Da    PI: 8.5972
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01016330001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.25e-42471461100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCkvlrr+C+++C+lapyfp+++p +f  +hk+FGasn++k lk++pe++r da+ss+vyeA+ar+ dPvyG++g i+klq+qle+++a
  GSVIVT01016330001  47 PCAACKVLRRRCTESCILAPYFPSTKPFQFITAHKVFGASNIIKWLKEVPETNRADAVSSMVYEANARILDPVYGCAGAISKLQKQLEEVQA 138
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        ela++++e
  GSVIVT01016330001 139 ELAMTQAE 146
                        ***99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.79446147IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4147144IPR004883Lateral organ boundaries, LOB
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009010anatomyseed
PO:0025501developmental stagefruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MEYTEKTTKP LKVFNSIHLF SSSSSSSSSS SSSSSRSSSF PAASQGPCAA CKVLRRRCTE  60
SCILAPYFPS TKPFQFITAH KVFGASNIIK WLKEVPETNR ADAVSSMVYE ANARILDPVY  120
GCAGAISKLQ KQLEEVQAEL AMTQAELLFM RCQQQQLDDN AKFHRNSGSA NWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-404715411118LOB family transfactor Ramosa2.1
5ly0_B2e-404715411118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4835101e-150AM483510.2 Vitis vinifera contig VV78X174222.12, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010658438.11e-126PREDICTED: LOB domain-containing protein 1
SwissprotQ9SK089e-51LBD11_ARATH; LOB domain-containing protein 11
TrEMBLD7TME01e-125D7TME0_VITVI; Uncharacterized protein
STRINGVIT_13s0019g03780.t011e-126(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.13e-52LOB domain-containing protein 11