PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01016328001
Common NameVIT_13s0019g03810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 140aa    MW: 15609 Da    PI: 8.2766
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01016328001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.78.2e-43121111100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaC++lrr+C+++C+lapyfp ++p kf n+hk+FGasn++k l++lp+ +r da+ss+vyeA+ar+rdPvyG++g+i++l++q++ lka
  GSVIVT01016328001  12 PCAACRFLRRRCNESCILAPYFPPNEPLKFINAHKVFGASNIVKALQELPQPKRVDAVSSMVYEANARIRDPVYGCAGTISQLHKQVNDLKA 103
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        ela++++e
  GSVIVT01016328001 104 ELAMAQAE 111
                        ****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.64311112IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-4212109IPR004883Lateral organ boundaries, LOB
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025242anatomyinfructescence axis
PO:0007017developmental stagesporophyte senescent stage
PO:0007089developmental stagestem elongation stage
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MFSPPSTAFQ GPCAACRFLR RRCNESCILA PYFPPNEPLK FINAHKVFGA SNIVKALQEL  60
PQPKRVDAVS SMVYEANARI RDPVYGCAGT ISQLHKQVND LKAELAMAQA ELFIMQCQQQ  120
QQNANASFFL DRYLVSDYC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4351193118LOB family transfactor Ramosa2.1
5ly0_B1e-4351193118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4698181e-136AM469818.2 Vitis vinifera contig VV78X059104.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275051.11e-100PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR09e-50LBD1_ARATH; LOB domain-containing protein 1
TrEMBLD7TMD82e-98D7TMD8_VITVI; Uncharacterized protein
STRINGVIT_13s0019g03810.t013e-99(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-51LOB domain-containing protein 1