PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01016327001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 299aa    MW: 32802.6 Da    PI: 7.9931
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01016327001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26097.91e-3018417100
             DUF260  17 vlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                        +lapyfp+++p +f ++h++FGasn++k+l++lpe++r da++s+vyeA++r+rdPvyG++g i++lq+q++ lkaela++++e
  GSVIVT01016327001   1 MLAPYFPSSEPLNFIIAHRVFGASNIIKFLQELPESKRADAARSMVYEANMRIRDPVYGCAGAISHLQNQVNGLKAELAMTQAE 84 
                        59*****************************************************************************99987 PP

2DUF260130.28.8e-411392381100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +C aCkvlrr+C+k+C lapyfp ++p kf n+hk++Gasn++k l++lpe++r da+ss+vyeA+ar+rdPvyG++g i++lq++l+ ++a
  GSVIVT01016327001 139 PCGACKVLRRRCTKSCLLAPYFPPTEPMKFINAHKIYGASNIVKCLQELPESKRADAVSSMVYEANARIRDPVYGCAGAISHLQKRLNDVQA 230
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        ela++++e
  GSVIVT01016327001 231 ELAMTQAE 238
                        ***99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.0E-29182IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089119.099185IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089124.953138239IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-40139236IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MLAPYFPSSE PLNFIIAHRV FGASNIIKFL QELPESKRAD AARSMVYEAN MRIRDPVYGC  60
AGAISHLQNQ VNGLKAELAM TQAELLIMQS QQQQQTHSAS SPLSLRMEEY NYKTSNTPFS  120
SSSSSRVSPL LSGSAVQGPC GACKVLRRRC TKSCLLAPYF PPTEPMKFIN AHKIYGASNI  180
VKCLQELPES KRADAVSSMV YEANARIRDP VYGCAGAISH LQKRLNDVQA ELAMTQAEIL  240
IMQSQQQQQQ QQQNDNAIQG LHTKSDFPDI AIPLLVIEET ASKKVAIAGL CLIDLTDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-40124011112LOB family transfactor Ramosa2.1
5ly0_B5e-40124011112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4833631e-117AM483363.2 Vitis vinifera contig VV78X217193.3, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019079772.14e-82PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR05e-53LBD1_ARATH; LOB domain-containing protein 1
TrEMBLF6HNJ31e-113F6HNJ3_VITVI; Uncharacterized protein
STRINGVIT_13s0019g03820.t011e-113(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.16e-52LOB domain-containing protein 11