PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01016326001
Common NameVIT_13s0019g03840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 136aa    MW: 14932.2 Da    PI: 5.633
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01016326001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26080.13.7e-2527329100
             DUF260  29 kfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                        kf n+hk++Gasn++k l++lpe++r da+ss+vyeA+ar+rdPvyG++g i++l ++l+ ++aela++++e
  GSVIVT01016326001   2 KFINAHKIYGASNIVKCLQELPESKRADAVSSMVYEANARIRDPVYGCAGAISHLLKRLNDVQAELAMTQAE 73 
                        799*****************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.35174IPR004883Lateral organ boundaries, LOB
PfamPF031956.2E-24271IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MKFINAHKIY GASNIVKCLQ ELPESKRADA VSSMVYEANA RIRDPVYGCA GAISHLLKRL  60
NDVQAELAMT QAEILIMQSQ QQQQQQQQQQ NDNAIQGLHT KSDFPDIAIP LLVIEETASK  120
KVAIAGLCLI ELTDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-2327539112LOB family transfactor Ramosa2.1
5ly0_B2e-2327539112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4833631e-110AM483363.2 Vitis vinifera contig VV78X217193.3, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010658649.15e-62PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR03e-33LBD1_ARATH; LOB domain-containing protein 1
TrEMBLF6HNJ14e-93F6HNJ1_VITVI; Uncharacterized protein
STRINGVIT_13s0019g03840.t017e-94(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.12e-33LOB domain-containing protein 11