PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01016272001
Common NameLOC100261558, VIT_13s0019g04320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 841aa    MW: 91699.6 Da    PI: 6.7182
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01016272001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.79.5e-192885457
                       -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         ++t+eq+e+Le++++++++ps ++r++L +++    +++ +q+kvWFqNrR +ek+
  GSVIVT01016272001 28 YVRYTAEQVEALERVYAECPKPSSTRRQQLIRECpilsNIESKQIKVWFQNRRCREKQ 85
                       5789****************************************************97 PP

2bZIP_120.79.1e-07791221861
                        HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1  18 rrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                        rr+R++ k+e  +L+   k+L + Nk L +e+e+l+k+v++l  
  GSVIVT01016272001  79 RRCREKQKKEAVQLQSVNKKLNSMNKLLMEENERLQKQVSQLVY 122
                        9***************************************9965 PP

3START162.62.9e-511663732204
                        HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT..EEE CS
              START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg..gal 91 
                        +aeea+ e+++ka+ ++  Wv+ + +++g++++ +++ s++++g a+ra+ +v  +++ + +e+l+d++ W ++++k e+ ++   g  g+l
  GSVIVT01016272001 166 IAEEAMGEFLSKAKGTAVDWVQIPGMKPGPDSVGTVAISHSCNGVAARACSLVSLEPT-EIMEILKDRQSWFRDCRKLEVFAKFPAGngGIL 256
                        799*******************************************************.7888888888****************9999*** PP

                        EEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHH CS
              START  92 qlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvdlkgrlphw 179
                        +l++++ +a+++l+p Rdf+++Ry+ +l++g++v++++S +     p+    s++vRa++lpSg+li+p+++g+s +++v+h dl+++++++
  GSVIVT01016272001 257 ELIYMQVYAPTTLAPaRDFWTLRYTSSLEDGSLVVCERSMSGSGAGPNpstASQFVRAKMLPSGYLIRPCEGGGSIIHIVDHLDLEAWSVPE 348
                        ****************************************988777777789**************************************** PP

                        HHHHHHHHHHHHHHHHHHHHTXXXX CS
              START 180 llrslvksglaegaktwvatlqrqc 204
                        +l++l+ks+   ++k++va+l++ +
  GSVIVT01016272001 349 VLQPLYKSSKLVAQKMTVAALHHIR 373
                        *********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-18582IPR009057Homeodomain-like
PROSITE profilePS5007115.4352286IPR001356Homeobox domain
SuperFamilySSF466891.92E-162391IPR009057Homeodomain-like
SMARTSM003896.7E-142490IPR001356Homeobox domain
CDDcd000861.70E-152787No hitNo description
PfamPF000462.5E-162885IPR001356Homeobox domain
CDDcd146862.47E-679118No hitNo description
Gene3DG3DSA:1.20.5.1706.4E-483134No hitNo description
PROSITE profilePS5084828.083156384IPR002913START domain
SMARTSM002346.7E-40165375IPR002913START domain
SuperFamilySSF559612.75E-34165377No hitNo description
PfamPF018527.5E-49166373IPR002913START domain
Gene3DG3DSA:3.30.530.202.0E-19166349IPR023393START-like domain
PfamPF086708.8E-49697839IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 841 aa     Download sequence    Send to blast
MSTPSNSSTS LKSSGGGAGG GGGGDGKYVR YTAEQVEALE RVYAECPKPS STRRQQLIRE  60
CPILSNIESK QIKVWFQNRR CREKQKKEAV QLQSVNKKLN SMNKLLMEEN ERLQKQVSQL  120
VYENGYMKQQ LQNVTATTTD TRCDSLVATP QHSSRTGNNP IGLLSIAEEA MGEFLSKAKG  180
TAVDWVQIPG MKPGPDSVGT VAISHSCNGV AARACSLVSL EPTEIMEILK DRQSWFRDCR  240
KLEVFAKFPA GNGGILELIY MQVYAPTTLA PARDFWTLRY TSSLEDGSLV VCERSMSGSG  300
AGPNPSTASQ FVRAKMLPSG YLIRPCEGGG SIIHIVDHLD LEAWSVPEVL QPLYKSSKLV  360
AQKMTVAALH HIRQIAQETS GDVTHTLGKQ PAVLRAFRQK LSRGFNDAIN GFNDDGWSLM  420
QIDGAEDLII SVNSAKNLST ISNSTAALSL PGGILCVKAA MLLQNVSPSL MVRFLREHRS  480
EWADFSVDAY AAASLRGDSF ALPGLSPSQF SGNQTTMSLG ITAENEILEI IQLEGHALSQ  540
EEASVMWRNI HLLQICNGVD DNAGEACSEL VFSPIDEMFP DDAPILSSGF RILELDAKTC  600
DRQDMLAAKR MMNLASNLEV RSSDATGCTA SSSDSRSVLI IAFQFLFESH LQGNVVTMAR  660
QYARNVISSV QRVAMAITPS GLHGRPKSTS GSPEALTLAR WICQSYSFHL GDQLLKSNYH  720
GGDSVLKQLW HHQDAILCCS LKLHPVFIFA NQAGLDMLET TLVALQDVSL DKIFDEAGRK  780
ALCNVVPQVM QQGFALVPAG IGMSTMGRHV SFEQAIAWKV LTEENTVHCL AFAFINWSFV  840
*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the earliest stages and throughout LSM initiation and development. In embryo development, expressed at the heart stage until the 'walking stick' stage in the adaxial portion of the cotyledon primordia, the shoot apical meristem (SAM) and the vascular precursor cells of the hypocotyl and root. In developing flowers, expressed first at stage 1 in the center of L3 layer and then expands to the center of L2 and L1 layers. Expressed in the center of flower meristem through stages 4 and 5. At stage 6, expressed in the adaxial side of the carpel primordia and then on the adaxial carpel face. {ECO:0000269|PubMed:11169198}.
UniprotTISSUE SPECIFICITY: Expressed in the interfascicular regions of stem and vascular bundles of young roots and leaves. {ECO:0000269|PubMed:10559440}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of interfascicular fiber (cortical cells) and secondary xylem differentiation in the inflorescence stems. Required for lateral shoot meristems (LSMs) and flower meristems (FMs) initiation. May be involved in the determination of vascular patterning and organ polarity (PubMed:10559440, PubMed:11169198, PubMed:11402186, PubMed:15111711, PubMed:15598805, PubMed:7555701). Directly regulates the expression of AGO10, ZPR1, ZPR2, ZPR3 and ZPR4 (PubMed:22781836). Required to regulate adaxial-abaxial polarity and leaf axial patterning (PubMed:20807212). {ECO:0000269|PubMed:10559440, ECO:0000269|PubMed:11169198, ECO:0000269|PubMed:11402186, ECO:0000269|PubMed:15111711, ECO:0000269|PubMed:15598805, ECO:0000269|PubMed:20807212, ECO:0000269|PubMed:22781836, ECO:0000269|PubMed:7555701}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. Repressed by ZPR and miR165. Induced by DOF5.1 (PubMed:20807212). {ECO:0000269|PubMed:15111711, ECO:0000269|PubMed:17237362, ECO:0000269|PubMed:20807212}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4539911e-180AM453991.2 Vitis vinifera contig VV78X064756.3, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002274194.10.0PREDICTED: homeobox-leucine zipper protein REVOLUTA isoform X1
SwissprotQ9SE430.0REV_ARATH; Homeobox-leucine zipper protein REVOLUTA
TrEMBLF6HNG30.0F6HNG3_VITVI; Uncharacterized protein
STRINGVIT_13s0019g04320.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6511671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60690.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Lian H,Li X,Liu Z,He Y
    HYL1 is required for establishment of stamen architecture with four microsporangia in Arabidopsis.
    J. Exp. Bot., 2013. 64(11): p. 3397-410
    [PMID:23918970]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Baima S, et al.
    Negative feedback regulation of auxin signaling by ATHB8/ACL5-BUD2 transcription module.
    Mol Plant, 2014. 7(6): p. 1006-1025
    [PMID:24777988]
  4. Jia X, et al.
    Functional plasticity of miR165/166 in plant development revealed by small tandem target mimic.
    Plant Sci., 2015. 233: p. 11-21
    [PMID:25711809]
  5. Roodbarkelari F,Du F,Truernit E,Laux T
    ZLL/AGO10 maintains shoot meristem stem cells during Arabidopsis embryogenesis by down-regulating ARF2-mediated auxin response.
    BMC Biol., 2015. 13: p. 74
    [PMID:26358077]
  6. Shi B, et al.
    Two-Step Regulation of a Meristematic Cell Population Acting in Shoot Branching in Arabidopsis.
    PLoS Genet., 2016. 12(7): p. e1006168
    [PMID:27398935]